Details of the Drug Therapeutic Target (DTT)
General Information of Drug Therapeutic Target (DTT) (ID: TTI6LBU)
| DTT Name | CD74 messenger RNA (CD74 mRNA) | ||||
|---|---|---|---|---|---|
| Synonyms |
p33 (mRNA); Ii (mRNA); Ia antigenassociated invariant chain (mRNA); Ia antigen-associated invariant chain (mRNA); HLADR antigensassociated invariant chain (mRNA); HLA-DR antigens-associated invariant chain (mRNA); HLA class II histocompatibility antigen gamma chain (mRNA); DHLAG (mRNA)
|
||||
| Gene Name | CD74 | ||||
| DTT Type |
Literature-reported target
|
[1] | |||
| BioChemical Class |
mRNA target
|
||||
| UniProt ID | |||||
| TTD ID | |||||
| 3D Structure | |||||
| Sequence |
MHRRRSRSCREDQKPVMDDQRDLISNNEQLPMLGRRPGAPESKCSRGALYTGFSILVTLL
LAGQATTAYFLYQQQGRLDKLTVTSQNLQLENLRMKLPKPPKPVSKMRMATPLLMQALPM GALPQGPMQNATKYGNMTEDHVMHLLQNADPLKVYPPLKGSFPENLRHLKNTMETIDWKV FESWMHHWLLFEMSRHSLEQKPTDAPPKVLTKCQEEVSHIPAVHPGSFRPKCDENGNYLP LQCYGSIGYCWCVFPNGTEVPNTRSRGHHNCSESLELEDPSSGLGVTKQDLGPVPM |
||||
| Function |
Serves as cell surface receptor for the cytokine MIF. Plays a critical role in MHC class II antigen processing by stabilizing peptide-free class II alpha/beta heterodimers in a complex soon after their synthesis and directing transport of the complex from the endoplasmic reticulum to the endosomal/lysosomal system where the antigen processing and binding of antigenic peptides to MHC class II takes place.
|
||||
| KEGG Pathway | |||||
| Reactome Pathway | |||||
