Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTIB95A)

DTT Name	Pancreatic hormone (PH)
Synonyms	Pancreatic prohormone; Pancreatic polypeptide; Pancreatic icosapeptide; PPY; PP; PI; PH; Obinepitide
Gene Name	PPY
DTT Type	Clinical trial target	[1]
BioChemical Class	Neuropeptide Y
UniProt ID	PAHO_HUMAN
TTD ID	T35303
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Sequence	APLEPVYPGDNATPEQMAQYAADLRRYINMLTRPRY
Function	The physiological role for the icosapeptide has notyet been elucidated.
Reactome Pathway	G alpha (i) signalling events (R-HSA-418594 ) Peptide ligand-binding receptors (R-HSA-375276 )

Molecular Interaction Atlas (MIA) of This DTT

Molecular Interaction Atlas (MIA)

Jump to Detail Molecular Interaction Atlas of This DTT

1 Clinical Trial Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
PP-1420	DMQOW0H	Obesity	5B81	Phase 1/2	[1]
------------------------------------------------------------------------------------

References

1	Pharmacokinetics, adverse effects and tolerability of a novel analogue of human pancreatic polypeptide, PP 1420. Br J Clin Pharmacol. 2012 Feb;73(2):232-9.