Details of the Drug Therapeutic Target (DTT)
General Information of Drug Therapeutic Target (DTT) (ID: TTINE9B)
| DTT Name | Lymphocyte antigen 6D (LY6D) | ||||
|---|---|---|---|---|---|
| Synonyms | LY6D; E48 antigen; Desmoglein III (dg4) | ||||
| Gene Name | LY6D | ||||
| DTT Type |
Literature-reported target
|
[1] | |||
| UniProt ID | |||||
| TTD ID | |||||
| 3D Structure | |||||
| Sequence |
MRTALLLLAALAVATGPALTLRCHVCTSSSNCKHSVVCPASSRFCKTTNTVEPLRGNLVK
KDCAESCTPSYTLQGQVSSGTSSTQCCQEDLCNEKLHNAAPTRTALAHSALSLGLALSLL AVILAPSL |
||||
| Function | May act as a specification marker at earliest stage specification of lymphocytes between B- and T-cell development. Marks the earliest stage of B-cell specification. | ||||
| Reactome Pathway | |||||
