Details of the Drug Therapeutic Target (DTT)
General Information of Drug Therapeutic Target (DTT) (ID: TTKGY3F)
| DTT Name | Mycobacterium DTDP-dehydrorhamnose epimerase rmlC (MycB rmlC) | ||||
|---|---|---|---|---|---|
| Synonyms |
dTDP-L-rhamnose synthase; dTDP-6-deoxy-D-xylo-4-hexulose 3,5-epimerase; dTDP-4-keto-6-deoxyglucose 3,5-epimerase; dTDP-4-dehydrorhamnose 3,5-epimerase; Thymidine diphospho-4-keto-rhamnose 3,5-epimerase
|
||||
| Gene Name | MycB rmlC | ||||
| DTT Type |
Literature-reported target
|
[1] | |||
| BioChemical Class |
Racemases and epimerases
|
||||
| UniProt ID | |||||
| TTD ID | |||||
| 3D Structure | |||||
| EC Number |
EC 5.1.3.13
|
||||
| Sequence |
MKARELDVPGAWEITPTIHVDSRGLFFEWLTDHGFRAFAGHSLDVRQVNCSVSSAGVLRG
LHFAQLPPSQAKYVTCVSGSVFDVVVDIREGSPTFGRWDSVLLDDQDRRTIYVSEGLAHG FLALQDNSTVMYLCSAEYNPQREHTICATDPTLAVDWPLVDGAAPSLSDRDAAAPSFEDV RASGLLPRWEQTQRFIGEMRGT |
||||
| Function |
Catalyzes the epimerization of the C3' and C5'positions of dTDP-6-deoxy-D-xylo-4-hexulose, forming dTDP-6-deoxy-L-lyxo-4-hexulose. Involved in the biosynthesis of the dTDP-L-rhamnose which is a component of the critical linker, D-N-acetylglucosamine-L-rhamnose disaccharide, which connects the galactan region of arabinogalactan to peptidoglycan via a phosphodiester linkage.
|
||||
| KEGG Pathway | |||||
Molecular Interaction Atlas (MIA) of This DTT
| Molecular Interaction Atlas (MIA) | ||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
1 Investigative Drug(s) Targeting This DTT
|
||||||||||||||||||||||||||||
