Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTKPS7V)

DTT Name	TNF superfamily receptor 12A (TNFRSF12A)
Synonyms	TweakR; Tweak-receptor; Tumor necrosis factor receptor superfamily member 12A; Fibroblast growth factor-inducible immediate-early response protein 14; FN14; FGF-inducible 14; CD266
Gene Name	TNFRSF12A
DTT Type	Clinical trial target	[1]
BioChemical Class	Cytokine receptor
UniProt ID	TNR12_HUMAN
TTD ID	T28717
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Sequence	MARGSLRRLLRLLVLGLWLALLRSVAGEQAPGTAPCSRGSSWSADLDKCMDCASCRARPH SDFCLGCAAAPPAPFRLLWPILGGALSLTFVLGLLSGFLVWRRCRRREKFTTPIEETGGE GCPAVALIQ
Function	Weak inducer of apoptosis in some cell types. Promotes angiogenesis and the proliferation of endothelial cells. May modulate cellular adhesion to matrix proteins. Receptor for TNFSF12/TWEAK.
KEGG Pathway	Cytokine-cytokine receptor interaction (hsa04060 )
Reactome Pathway	TNF receptor superfamily (TNFSF) members mediating non-canonical NF-kB pathway (R-HSA-5676594 ) TNFR2 non-canonical NF-kB pathway (R-HSA-5668541 )

Molecular Interaction Atlas (MIA) of This DTT

Molecular Interaction Atlas (MIA)

Jump to Detail Molecular Interaction Atlas of This DTT

1 Clinical Trial Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Enavatuzumab	DMBIPQL	Solid tumour/cancer	2A00-2F9Z	Phase 1	[1]
------------------------------------------------------------------------------------

Molecular Expression Atlas (MEA) of This DTT

Molecular Expression Atlas (MEA)

Jump to Detail Molecular Expression Atlas of This DTT

Disease Name	ICD 11	Studied Tissue	p-value	Fold-Change	Z-score
Rheumatoid arthritis	FA20	Synovial tissue	6.05E-05	0.72	1.75
------------------------------------------------------------------------------------

References

1	Expression of TweakR in breast cancer and preclinical activity of enavatuzumab, a humanized anti-TweakR mAb. J Cancer Res Clin Oncol. 2013 Feb;139(2):315-25.