Details of the Drug Therapeutic Target (DTT)
General Information of Drug Therapeutic Target (DTT) (ID: TTKU0LS)
| DTT Name | Toll/interleukin-1 receptor domain-containing adapter (TIRAP) | ||||
|---|---|---|---|---|---|
| Synonyms | Toll/interleukin-1 receptor domain-containing adapter protein; TIR domain-containing adapter protein; MyD88-2; MyD88 adapter-like protein; MAL; Adaptor protein Wyatt | ||||
| Gene Name | TIRAP | ||||
| DTT Type |
Patented-recorded target
|
[1] | |||
| UniProt ID | |||||
| TTD ID | |||||
| 3D Structure | |||||
| Sequence |
MASSTSLPAPGSRPKKPLGKMADWFRQTLLKKPKKRPNSPESTSSDASQPTSQDSPLPPS
LSSVTSPSLPPTHASDSGSSRWSKDYDVCVCHSEEDLVAAQDLVSYLEGSTASLRCFLQL RDATPGGAIVSELCQALSSSHCRVLLITPGFLQDPWCKYQMLQALTEAPGAEGCTIPLLS GLSRAAYPPELRFMYYVDGRGPDGGFRQVKEAVMRYLQTLS |
||||
| Function |
Acts via IRAK2 and TRAF-6, leading to the activation of NF-kappa-B, MAPK1, MAPK3 and JNK, and resulting in cytokine secretion and the inflammatory response. Positively regulates the production of TNF-alpha and interleukin-6. Adapter involved in TLR2 and TLR4 signaling pathways in the innate immune response.
|
||||
| KEGG Pathway | |||||
| Reactome Pathway | |||||