Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTL3H2W)

• DTT Name: SARS-CoV envelope small membrane protein (E)
• Synonyms: SARS-CoV E protein; SARS-CoV sM protein
• Gene Name: SARS-CoV E
• BioChemical Class: Betacoronaviruses E protein family.
• UniProt ID: VEMP_CVHSA
• TTD ID: T11566
• Sequence:
  MYSFVSEETGTLIVNSVLLFLAFVVFLLVTLAILTALRLCAYCCNIVNVSLVKPTVYVYS
  RVKNLNSSEGVPDLLV
• Function: Plays a central role in virus morphogenesis and assembly. Acts as a viroporin and self-assembles in host membranes forming pentameric protein-lipid pores that allow ion transport. Also plays a role in the induction of apoptosis (By similarity). Activates the host NLRP3 inflammasome, leading to IL-1beta overproduction.
• Reactome Pathway:
  Virion Assembly and Release (R-HSA-9679509)
  Maturation of protein E (R-HSA-9683683)
  Translation of Structural Proteins (R-HSA-9683701)
  SARS-CoV-1-host interactions (R-HSA-9767675)
  Attachment and Entry (R-HSA-9678110)

Molecular Interaction Atlas (MIA) of This DTT

1 Preclinical Drugs Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Hexamethylene amiloride	DMLZ5TQ	Severe acute respiratory syndrome (SARS)	1D65	Preclinical	[1]

References

• [1] Coronaviruses - drug discovery and therapeutic options. Nat Rev Drug Discov. 2016 May;15(5):327-47.