Details of the Drug Therapeutic Target (DTT)
General Information of Drug Therapeutic Target (DTT) (ID: TTLAYV8)
| DTT Name | Insulin-like growth factor-binding protein 6 (IGFBP6) | ||||
|---|---|---|---|---|---|
| Synonyms | IGFBP-6; IGF-binding protein 6; IBP6; IBP-6 | ||||
| Gene Name | IGFBP6 | ||||
| DTT Type | 
                     Literature-reported target 
                 | 
                [1] | |||
| BioChemical Class | 
                     Insulin-like growth factor binding 
                 | 
            ||||
| UniProt ID | |||||
| TTD ID | |||||
| 3D Structure | |||||
| Sequence | 
                                         
                            MTPHRLLPPLLLLLALLLAASPGGALARCPGCGQGVQAGCPGGCVEEEDGGSPAEGCAEA 
                        
                    EGCLRREGQECGVYTPNCAPGLQCHPPKDDEAPLRALLLGRGRCLPARAPAVAEENPKES KPQAGTARPQDVNRRDQQRNPGTSTTPSQPNSAGVQDTEMGPCRRHLDSVLQQLQTEVYR GAQTLYVPNCDHRGFYRKRQCRSSQGQRRGPCWCVDRMGKSLPGSPDGNGSSSCPTGSSG  | 
            ||||
| Function | 
                                         
                        IGF-binding proteins prolong the half-life of the IGFs and have been shown to either inhibit or stimulate the growth promoting effects of the IGFs on cell culture. They alter the interaction of IGFs with their cell surface receptors.
                        
                     
                                     | 
            ||||
| Reactome Pathway | |||||
