Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTLK9NJ)

DTT Name	Pseudomonas PcrV protein type III (Pseudo pcrV)
Synonyms	Type III secretion protein PcrV; Pseudo Virulence-associated V antigen; Pseudo Low calcium response locus protein V; PcrV
Gene Name	Pseudo pcrV
DTT Type	Clinical trial target	[1]
UniProt ID	O30527_PSEAI
TTD ID	T22415
Sequence	MEVRNLNAARELFLDELLAASAAPASAEQEELLALLRSERIVLAHAGQPLSEAQVLKALA WLLAANPSAPPGQGLEVLREVLQARRQPGAQWDLREFLVSAYFSLHGRLDEDVIGVYKDV LQTQDGKRKALLDELKALTAELKVYSVIQSQINAALSAKQGIRIDAGGIDLVDPTLYGYA VGDPRWKDSPEYALLSNLDTFSGKLSIKDFLSGSPKQSGELKGLSDEYPFEKDNNPVGNF ATTVSDRSRPLNDKVNEKTTLLNDTSSRYNSAVEALNRFIQKYDSVLRDILSAI
Function	Essential for cytotoxicity. Found both within the bacterial cytoplasm and localized extracellularly.

Molecular Interaction Atlas (MIA) of This DTT

Molecular Interaction Atlas (MIA)

Jump to Detail Molecular Interaction Atlas of This DTT

2 Clinical Trial Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
KB001A	DMTMCPZ	Cystic fibrosis	CA25	Phase 2	[2]
MEDI3902	DMOXKIC	Ventilator-associated pneumonia	PK81.0	Phase 2	[3]
------------------------------------------------------------------------------------

References

1	Interpreting expression profiles of cancers by genome-wide survey of breadth of expression in normal tissues. Genomics 2005 Aug;86(2):127-41.
2	KB001-A, a novel anti-inflammatory, found to be safe and well-tolerated in cystic fibrosis patients infected with Pseudomonas aeruginosa. J Cyst Fibros. 2018 Jul;17(4):484-491.
3	A multifunctional bispecific antibody protects against Pseudomonas aeruginosa. Sci Transl Med. 2014 Nov 12;6(262):262ra155.