Details of the Drug Therapeutic Target (DTT)
General Information of Drug Therapeutic Target (DTT) (ID: TTM18HX)
| DTT Name | Placenta specific protein 1 (PLAC1) | ||||
|---|---|---|---|---|---|
| Synonyms | Placentaspecific protein 1; PLAC1 | ||||
| Gene Name | PLAC1 | ||||
| DTT Type |
Literature-reported target
|
[1] | |||
| UniProt ID | |||||
| TTD ID | |||||
| 3D Structure | |||||
| Sequence |
MKVFKFIGLMILLTSAFSAGSGQSPMTVLCSIDWFMVTVHPFMLNNDVCVHFHELHLGLG
CPPNHVQPHAYQFTYRVTECGIRAKAVSQDMVIYSTEIHYSSKGTPSKFVIPVSCAAPQK SPWLTKPCSMRVASKSRATAQKDEKCYEVFSLSQSSQRPNCDCPPCVFSEEEHTQVPCHQ AGAQEAQPLQPSHFLDISEDWSLHTDDMIGSM |
||||
| Function | May play a role in placental development. | ||||
