Details of the Drug Therapeutic Target (DTT)
General Information of Drug Therapeutic Target (DTT) (ID: TTM1I7L)
| DTT Name | Voltage-dependent anion-selective channel 2 (VDAC2) | ||||
|---|---|---|---|---|---|
| Synonyms | hVDAC2; VDAC2; VDAC-2; Outer mitochondrial membrane protein porin 2 | ||||
| Gene Name | VDAC2 | ||||
| DTT Type |
Literature-reported target
|
[1] | |||
| BioChemical Class |
Eukaryotic mitochondrial porin
|
||||
| UniProt ID | |||||
| TTD ID | |||||
| 3D Structure | |||||
| Sequence |
MATHGQTCARPMCIPPSYADLGKAARDIFNKGFGFGLVKLDVKTKSCSGVEFSTSGSSNT
DTGKVTGTLETKYKWCEYGLTFTEKWNTDNTLGTEIAIEDQICQGLKLTFDTTFSPNTGK KSGKIKSSYKRECINLGCDVDFDFAGPAIHGSAVFGYEGWLAGYQMTFDSAKSKLTRNNF AVGYRTGDFQLHTNVNDGTEFGGSIYQKVCEDLDTSVNLAWTSGTNCTRFGIAAKYQLDP TASISAKVNNSSLIGVGYTQTLRPGVKLTLSALVDGKSINAGGHKVGLALELEA |
||||
| Function |
Forms a channel through the mitochondrial outer membrane that allows diffusion of small hydrophilic molecules. The channel adopts an open conformation at low or zero membrane potential and a closed conformation at potentials above 30-40 mV. The open state has a weak anion selectivity whereas the closed state is cation- selective.
|
||||
| KEGG Pathway | |||||
| Reactome Pathway | |||||