Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTM624L)

DTT Name Interleukin-29 (IL29)
Synonyms ZCYTO21; Interleukin29; Interferon lambda1; Interferon lambda-1; IL-29; IFNlambda1; IFN-lambda-1; Cytokine Zcyto21
Gene Name IFNL1
DTT Type
Clinical trial target
 [1]
BioChemical Class
Cytokine: interleukin
UniProt ID
IFNL1_HUMAN
TTD ID
T78381
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MAAAWTVVLVTLVLGLAVAGPVPTSKPTTTGKGCHIGRFKSLSPQELASFKKARDALEES
LKLKNWSCSSPVFPGNWDLRLLQVRERPVALEAELALTLKVLEAAAGPALEDVLDQPLHT
LHHILSQLQACIQPQPTAGPRPRGRLHHWLHRLQEAPKKESAGCLEASVTFNLFRLLTRD
LKYVADGNLCLRTSTHPEST
Function
Plays a critical role in the antiviral host defense, predominantly in the epithelial tissues. Acts as a ligand for the heterodimeric class II cytokine receptor composed of IL10RB and IFNLR1, and receptor engagement leads to the activation of the JAK/STAT signaling pathway resulting in the expression of IFN-stimulated genes (ISG), which mediate the antiviral state. Has a restricted receptor distribution and therefore restricted targets: is primarily active in epithelial cells and this cell type-selective action is because of the epithelial cell-specific expression of its receptor IFNLR1. Exerts an immunomodulatory effect by up-regulating MHC class I antigen expression. Cytokine with antiviral, antitumour and immunomodulatory activities.
KEGG Pathway
Cytokine-cytokine receptor interaction (hsa04060 )
Jak-STAT signaling pathway (hsa04630 )
Reactome Pathway
Interleukin-20 family signaling (R-HSA-8854691 )
Other interleukin signaling (R-HSA-449836 )

Molecular Interaction Atlas (MIA) of This DTT

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DTT
2 Clinical Trial Drug(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
Peginterferon lambda-1a DMK6OFY Acute myeloid leukaemia 2A60 Phase 3 [1]
PEG-Interferon lambda (IL-29) DMMEPKR Virus infection 1A24-1D9Z Phase 1 [1]
------------------------------------------------------------------------------------

Molecular Expression Atlas (MEA) of This DTT

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DTT
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2C82 Bone marrow 4.97E-01 -0.01 -0.02
------------------------------------------------------------------------------------

References

1 Preclinical and clinical development of pegylated interferon-lambda 1 in chronic hepatitis C. J Interferon Cytokine Res. 2010 Aug;30(8):591-5.