Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTMDW9L)

• DTT Name: Negative growth-regulatory protein MyD118 (GADD45B)
• Synonyms: Myeloid differentiation primary response protein MyD118; GADD45beta; GADD45B; DNA damage-inducible gene 45beta
• Gene Name: GADD45B
• DTT Type: Literature-reported target; [1]
• BioChemical Class: Ribosomal protein
• UniProt ID: GA45B_HUMAN
• TTD ID: T70797
• Sequence:
  MTLEELVACDNAAQKMQTVTAAVEELLVAAQRQDRLTVGVYESAKLMNVDPDSVVLCLLA
  IDEEEEDDIALQIHFTLIQSFCCDNDINIVRVSGMQRLAQLLGEPAETQGTTEARDLHCL
  LVTNPHTDAWKSHGLVEVASYCEESRGNNQWVPYISLQER
• Function: Involved in the regulation of growth and apoptosis. Mediates activation of stress-responsive MTK1/MEKK4 MAPKKK.
• KEGG Pathway:
  MAPK signaling pathway (hsa04010)
  NF-kappa B signaling pathway (hsa04064)
  FoxO signaling pathway (hsa04068)
  Cell cycle (hsa04110)
  p53 signaling pathway (hsa04115)
  Apoptosis (hsa04210)
  Cellular senescence (hsa04218)
  Epstein-Barr virus infection (hsa05169)
  Pathways in cancer (hsa05200)
  Transcriptional misregulation in cancer (hsa05202)
  Colorectal cancer (hsa05210)
  Pancreatic cancer (hsa05212)
  Endometrial cancer (hsa05213)
  Glioma (hsa05214)
  Thyroid cancer (hsa05216)
  Basal cell carcinoma (hsa05217)
  Melanoma (hsa05218)
  Chronic myeloid leukemia (hsa05220)
  Small cell lung cancer (hsa05222)
  Non-small cell lung cancer (hsa05223)
  Breast cancer (hsa05224)
  Hepatocellular carcinoma (hsa05225)
  Gastric cancer (hsa05226)

References

• [1] Down-regulation of growth arrest DNA damage-inducible gene 45beta expression is associated with human hepatocellular carcinoma. Am J Pathol. 2003 Jun;162(6):1961-74.