Details of the Drug Therapeutic Target (DTT)
General Information of Drug Therapeutic Target (DTT) (ID: TTMG98T)
| DTT Name | Heat shock protein 27 (HSP27) | ||||
|---|---|---|---|---|---|
| Synonyms | Protein 3; HspB3; Heat shock protein beta3; Heat shock 17 kDa protein; HSP 17 | ||||
| Gene Name | HSPB3 | ||||
| DTT Type |
Clinical trial target
|
[1] | |||
| BioChemical Class |
Heat shock protein
|
||||
| UniProt ID | |||||
| TTD ID | |||||
| 3D Structure | |||||
| Sequence |
MAKIILRHLIEIPVRYQEEFEARGLEDCRLDHALYALPGPTIVDLRKTRAAQSPPVDSAA
ETPPREGKSHFQILLDVVQFLPEDIIIQTFEGWLLIKAQHGTRMDEHGFISRSFTRQYKL PDGVEIKDLSAVLCHDGILVVEVKDPVGTK |
||||
| Function | Inhibitor of actin polymerization. | ||||
Molecular Interaction Atlas (MIA) of This DTT
| Molecular Interaction Atlas (MIA) | ||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
1 Clinical Trial Drug(s) Targeting This DTT
|
||||||||||||||||||||||||||||
|
1 Discontinued Drug(s) Targeting This DTT
|
||||||||||||||||||||||||||||
