Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTMHA6L)

• DTT Name: T-cell surface glycoprotein CD8 (CD8)
• Synonyms: T-lymphocyte differentiation antigen T8/Leu-2; CD8
• Gene Name: CD8A
• DTT Type: Clinical trial target; [1]
• UniProt ID: CD8A_HUMAN ; CD8B_HUMAN
• TTD ID: T20978
• Sequence:
  MALPVTALLLPLALLLHAARPSQFRVSPLDRTWNLGETVELKCQVLLSNPTSGCSWLFQP
  RGAAASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGYYFCSALSN
  SIMYFSHFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFA
  CDIYIWAPLAGTCGVLLLSLVITLYCNHRNRRRVCKCPRPVVKSGDKPSLSARYV
• Function: Identifies cytotoxic/suppressor T-cells that interact with MHC class I bearing targets. CD8 is thought to play a role in the process of T-cell mediated killing. CD8 alpha chains binds to class I MHC molecules alpha-3 domains.
• KEGG Pathway:
  Cell adhesion molecules (CAMs) (hsa04514)
  Antigen processing and presentation (hsa04612)
  Hematopoietic cell lineage (hsa04640)
  T cell receptor signaling pathway (hsa04660)
  Primary immunodeficiency (hsa05340)
• Reactome Pathway: Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell (R-HSA-198933)

Molecular Interaction Atlas (MIA) of This DTT

3 Clinical Trial Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Fluoropeptide vaccine	DMCEUOH	Influenza virus infection	1E30-1E32	Phase 2	[1]
Anti-VEGFR2 CD8 cell therapy	DM2910G	Solid tumour/cancer	2A00-2F9Z	Phase 1/2	[2]
LIPO-4	DMJRALD	Human immunodeficiency virus infection	1C62	Phase 1	[3]

References

• [1] A novel peptide-based pan-influenza A vaccine: a double blind, randomised clinical trial of immunogenicity and safety. Vaccine. 2015 Jan 3;33(2):396-402.
• [2] Vascular normalizing doses of antiangiogenic treatment reprogram the immunosuppressive tumor microenvironment and enhance immunotherapy. Proc Natl Acad Sci U S A. 2012 Oct 23;109(43):17561-6.
• [3] Long-term CD4(+) and CD8(+) T-cell responses induced in HIV-uninfected volunteers following intradermal or intramuscular administration of an HIV-lipopeptide vaccine (ANRS VAC16). Vaccine. 2013 Sep 13;31(40):4406-15.