Details of the Drug Therapeutic Target (DTT)
General Information of Drug Therapeutic Target (DTT) (ID: TTMVAIU)
| DTT Name | Thymosin beta-4 (TMSB4X) | ||||
|---|---|---|---|---|---|
| Synonyms | TMSB4X; T beta-4; Fx | ||||
| Gene Name | TMSB4X | ||||
| DTT Type |
Literature-reported target
|
[1] | |||
| BioChemical Class |
Thymosin family
|
||||
| UniProt ID | |||||
| TTD ID | |||||
| 3D Structure | |||||
| Sequence |
MSDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
|
||||
| Function | Seraspenide inhibits the entry of hematopoietic pluripotent stem cellsinto the S-phase. | ||||
| KEGG Pathway | |||||
| Reactome Pathway | |||||
