Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTN7Y4P)

• DTT Name: Sodium/glucose cotransporter 2 (SLC5A4)
• Synonyms: Sodium/glucose cotransporter 4; SLC5A4
• Gene Name: SLC5A4
• DTT Type: Clinical trial target; [1]
• BioChemical Class: Solute:sodium symporter
• UniProt ID: SC5A4_HUMAN
• TTD ID: T22583
• Sequence:
  MASTVSPSTIAETPEPPPLSDHIRNAADISVIVIYFLVVMAVGLWAMLKTNRGTIGGFFL
  AGRDMAWWPMGASLFASNIGSNHYVGLAGTGAASGVATVTFEWTSSVMLLILGWIFVPIY
  IKSGVMTMPEYLKKRFGGERLQVYLSILSLFICVVLLISADIFAGAIFIKLALGLDLYLA
  IFILLAMTAVYTTTGGLASVIYTDTLQTIIMLIGSFILMGFAFNEVGGYESFTEKYVNAT
  PSVVEGDNLTISASCYTPRADSFHIFRDAVTGDIPWPGIIFGMPITALWYWCTNQVIVQR
  CLCGKDMSHVKAACIMCAYLKLLPMFLMVMPGMISRILYTDMVACVVPSECVKHCGVDVG
  CTNYAYPTMVLELMPQGLRGLMLSVMLASLMSSLTSIFNSASTLFTIDLYTKMRKQASEK
  ELLIAGRIFVLLLTVVSIVWVPLVQVSQNGQLIHYTESISSYLGPPIAAVFVLAIFCKRV
  NEQGAFWGLMVGLAMGLIRMITEFAYGTGSCLAPSNCPKIICGVHYLYFSIVLFFGSMLV
  TLGISLLTKPIPDVHLYRLCWVLRNSTEERIDIDAEEKSQEETDDGVEEDYPEKSRGCLK
  KAYDLFCGLQKGPKLTKEEEEALSKKLTDTSERPSWRTIVNINAILLLAVVVFIHGYYA
• Function: Sodium-dependent glucose transporter.
• Reactome Pathway:
  Na+-dependent glucose transporters (R-HSA-428808)
  Inositol transporters (R-HSA-429593)
  Hexose transport (R-HSA-189200)

Molecular Interaction Atlas (MIA) of This DTT

4 Clinical Trial Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
RG7201	DMJRFYB	Type-2 diabetes	5A11	Phase 3	[2]
SaxaDapa FDC	DMAPRWV	Diabetic complication	5A2Y	Phase 3	[1]
Remogli ozin-etabonate	DMZFV3E	Type-2 diabetes	5A11	Phase 2	[3]
Remogliflozin etabonate	DMW4YK1	Type-1/2 diabetes	5A10-5A11	Phase 2	[4]

1 Discontinued Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Ponalrestat	DM04ZUW	Gout	FA25	Discontinued in Phase 3	[5]

Molecular Expression Atlas (MEA) of This DTT

Disease Name	ICD 11	Studied Tissue	p-value	Fold-Change	Z-score
Type 2 diabetes	5A11	Liver tissue	3.26E-01	-0.09	-0.37

The Drug Transporter (DTP) Role of This DTT

• DTT DTP Name: Sodium/glucose cotransporter 3 (SLC5A4) DTP Info
• Gene Name: SLC5A4

1 Approved Drug(s) Transported by This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
2-deoxyglucose	DMIAHVU	Solid tumour/cancer	2A00-2F9Z	Approved	[6]

References

• [1] Saxagliptin: a new dipeptidyl peptidase-4 inhibitor for type 2 diabetes. Cardiol Rev. 2010 Jul-Aug;18(4):213-7.
• [2] Efficacy and safety of monotherapy with the novel sodium/glucose cotransporter-2 inhibitor tofogliflozin in Japanese patients with type 2 diabetes mellitus: a combined Phase 2 and 3 randomized, placebo-controlled, double-blind, parallel-group comparative study. Cardiovasc Diabetol. 2014 Mar 28;13:65.
• [3] Safety, pharmacokinetics and pharmacodynamics of remogliflozin etabonate, a novel SGLT2 inhibitor, and metformin when co-administered in subjects with type 2 diabetes mellitus. BMC Pharmacol Toxicol.2013 Apr 30;14:25.
• [4] Clinical pipeline report, company report or official report of GlaxoSmithKline (2009).
• [5] Clinical pipeline report, company report or official report of ISIS Pharmaceuticals (2009).
• [6] The sodium/glucose cotransport family SLC5. Pflugers Arch. 2004 Feb;447(5):510-8.