Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTNH25W)

• DTT Name: Prolyl 4-hydroxylasesubunit alpha-1 (P4HA1)
• Synonyms: Prolyl 4-hydroxylase subunit alpha-1; Procollagenproline,2oxoglutarate4dioxygenase subunit alpha1; Procollagen-proline,2-oxoglutarate-4-dioxygenase subunit alpha-1; P4HA; 4PH alpha1; 4-PH alpha-1
• Gene Name: P4HA1
• DTT Type: Clinical trial target; [1]
• BioChemical Class: Paired donor oxygen oxidoreductase
• UniProt ID: P4HA1_HUMAN
• TTD ID: T61729
• EC Number: EC 1.14.11.2
• Sequence:
  MIWYILIIGILLPQSLAHPGFFTSIGQMTDLIHTEKDLVTSLKDYIKAEEDKLEQIKKWA
  EKLDRLTSTATKDPEGFVGHPVNAFKLMKRLNTEWSELENLVLKDMSDGFISNLTIQRQY
  FPNDEDQVGAAKALLRLQDTYNLDTDTISKGNLPGVKHKSFLTAEDCFELGKVAYTEADY
  YHTELWMEQALRQLDEGEISTIDKVSVLDYLSYAVYQQGDLDKALLLTKKLLELDPEHQR
  ANGNLKYFEYIMAKEKDVNKSASDDQSDQKTTPKKKGVAVDYLPERQKYEMLCRGEGIKM
  TPRRQKKLFCRYHDGNRNPKFILAPAKQEDEWDKPRIIRFHDIISDAEIEIVKDLAKPRL
  RRATISNPITGDLETVHYRISKSAWLSGYENPVVSRINMRIQDLTGLDVSTAEELQVANY
  GVGGQYEPHFDFARKDEPDAFKELGTGNRIATWLFYMSDVSAGGATVFPEVGASVWPKKG
  TAVFWYNLFASGEGDYSTRHAACPVLVGNKWVSNKWLHERGQEFRRPCTLSELE
• Function: Catalyzes the post-translational formation of 4-hydroxyproline in -Xaa-Pro-Gly- sequences in collagens and other proteins.
• KEGG Pathway:
  Arginine and proline metabolism (hsa00330)
  Metabolic pathways (hsa01100)
• Reactome Pathway: Collagen biosynthesis and modifying enzymes (R-HSA-1650814)
• BioCyc Pathway: MetaCyc:HS04613-MON

Molecular Interaction Atlas (MIA) of This DTT

2 Clinical Trial Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Lufironil	DMCKNBA	Liver cirrhosis	DB93.1	Phase 2	[1]
SAFIRONIL	DM1UIQP	Transplant rejection	NE84	Phase 1	[2]

The Drug-Metabolizing Enzyme (DME) Role of This DTT

• DTT DME Name: Prolyl 4-hydroxylase alpha-1 (P4HA1) DME Info
• Gene Name: P4HA1

1 Approved Drug(s) Metabolized by This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Vitamin C	DMXJ7O8	Adenocarcinoma	2D40	Approved	[3]

1 Investigative Drug(s) Metabolized by This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
alpha-ketoglutaric acid	DM5LFYN	Discovery agent	N.A.	Investigative	[3]

References

• [1] Interference in clinical laboratory tests, with special regard to the bilirubin assay: effects of a metabolite of the new prolyl 4-hydroxylase inhibitor, Lufironil. Eur J Clin Chem Clin Biochem. 1994Jul;32(7):515-20.
• [2] Antifibrogenic therapies in chronic HCV infection. Curr Drug Targets Infect Disord. 2001 Aug;1(2):227-40.
• [3] Prolyl 4-hydroxylases, the key enzymes of collagen biosynthesis. Matrix Biol. 2003 Mar;22(1):15-24.