Details of the Drug Therapeutic Target (DTT)
General Information of Drug Therapeutic Target (DTT) (ID: TTNLDK6)
| DTT Name | Cardiac troponin I (TNNI3) | ||||
|---|---|---|---|---|---|
| Synonyms | TNNI3 | ||||
| Gene Name | TNNI3 | ||||
| DTT Type |
Literature-reported target
|
[1] | |||
| BioChemical Class |
Troponin
|
||||
| UniProt ID | |||||
| TTD ID | |||||
| 3D Structure | |||||
| Sequence |
MADGSSDAAREPRPAPAPIRRRSSNYRAYATEPHAKKKSKISASRKLQLKTLLLQIAKQE
LEREAEERRGEKGRALSTRCQPLELAGLGFAELQDLCRQLHARVDKVDEERYDIEAKVTK NITEIADLTQKIFDLRGKFKRPTLRRVRISADAMMQALLGARAKESLDLRAHLKQVKKED TEKENREVGDWRKNIDALSGMEGRKKKFES |
||||
| Function | Troponin I is the inhibitory subunit of troponin, the thin filament regulatory complex which confers calcium-sensitivity to striated muscle actomyosin ATPase activity. | ||||
| KEGG Pathway | |||||
| Reactome Pathway | |||||
