| DTT Name |
Gamma-Histone H2AX (H2AFX)
|
| Synonyms |
Phosphorylation of H2AX; Histone H2AX; Histone H2A.x; H2a/x; H2AX |
| Gene Name |
H2AFX
|
| DTT Type |
Literature-reported target
|
[1] |
| UniProt ID |
|
| TTD ID |
|
| 3D Structure |
|
| Sequence |
MSGRGKTGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGHYAERVGAGAPVYLAAVLEYLT
AEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKK
TSATVGPKAPSGGKKATQASQEY
|
| Function |
Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling. Required for checkpoint-mediated arrest of cell cycle progression in response to low doses of ionizing radiation and for efficient repair of DNA double strand breaks (DSBs) specifically when modified by C-terminal phosphorylation. Variant histone H2A which replaces conventional H2A in a subset of nucleosomes.
|
| KEGG Pathway |
- Necroptosis (hsa04217 )
- Neutrophil extracellular trap formation (hsa04613 )
- Alcoholism (hsa05034 )
- Systemic lupus erythematosus (hsa05322 )
|
| Reactome Pathway |
- Cleavage of the damaged pyrimidine (R-HSA-110329 )
- Recognition and association of DNA glycosylase with site containing an affected purine (R-HSA-110330 )
- Cleavage of the damaged purine (R-HSA-110331 )
- Meiotic synapsis (R-HSA-1221632 )
- Packaging Of Telomere Ends (R-HSA-171306 )
- Pre-NOTCH Transcription and Translation (R-HSA-1912408 )
- Formation of the beta-catenin (R-HSA-201722 )
- PRC2 methylates histones and DNA (R-HSA-212300 )
- Condensation of Prophase Chromosomes (R-HSA-2299718 )
- Oxidative Stress Induced Senescence (R-HSA-2559580 )
- Senescence-Associated Secretory Phenotype (SASP) (R-HSA-2559582 )
- DNA Damage/Telomere Stress Induced Senescence (R-HSA-2559586 )
- RMTs methylate histone arginines (R-HSA-3214858 )
- SIRT1 negatively regulates rRNA expression (R-HSA-427359 )
- ERCC6 (CSB) and EHMT2 (G9a) positively regulate rRNA expression (R-HSA-427389 )
- NoRC negatively regulates rRNA expression (R-HSA-427413 )
- B-WICH complex positively regulates rRNA expression (R-HSA-5250924 )
- DNA methylation (R-HSA-5334118 )
- Transcriptional regulation by small RNAs (R-HSA-5578749 )
- Activation of anterior HOX genes in hindbrain development during early embryogenesis (R-HSA-5617472 )
- Activated PKN1 stimulates transcription of AR (androgen receptor) regulated genes KLK2 and KLK3 (R-HSA-5625886 )
- Recruitment and ATM-mediated phosphorylation of repair and signaling proteins at DNA double strand breaks (R-HSA-5693565 )
- Nonhomologous End-Joining (NHEJ) (R-HSA-5693571 )
- Processing of DNA double-strand break ends (R-HSA-5693607 )
- Deposition of new CENPA-containing nucleosomes at the centromere (R-HSA-606279 )
- Assembly of the ORC complex at the origin of replication (R-HSA-68616 )
- G2/M DNA damage checkpoint (R-HSA-69473 )
- RNA Polymerase I Promoter Opening (R-HSA-73728 )
- RNA Polymerase I Promoter Escape (R-HSA-73772 )
- RUNX1 regulates genes involved in megakaryocyte differentiation and platelet function (R-HSA-8936459 )
- RUNX1 regulates transcription of genes involved in differentiation of HSCs (R-HSA-8939236 )
- Estrogen-dependent gene expression (R-HSA-9018519 )
- Meiotic recombination (R-HSA-912446 )
- Transcriptional regulation of granulopoiesis (R-HSA-9616222 )
- Inhibition of DNA recombination at telomere (R-HSA-9670095 )
- Defective pyroptosis (R-HSA-9710421 )
- Amyloid fiber formation (R-HSA-977225 )
- Recognition and association of DNA glycosylase with site containing an affected pyrimidine (R-HSA-110328 )
|
|
|
|
|
|
|
