Details of the Drug Therapeutic Target (DTT)
General Information of Drug Therapeutic Target (DTT) (ID: TTO3MV6)
| DTT Name | Bacterial GTP-binding protein YihA (Bact engB) | ||||
|---|---|---|---|---|---|
| Synonyms | engB; Probable GTP-binding protein engB | ||||
| Gene Name | Bact engB | ||||
| DTT Type |
Literature-reported target
|
[1] | |||
| UniProt ID | |||||
| TTD ID | |||||
| 3D Structure | |||||
| Sequence |
MTNLNYQQTHFVMSAPDIRHLPSDTGIEVAFAGRSNAGKSSALNTLTNQKSLARTSKTPG
RTQLINLFEVADGKRLVDLPGYGYAEVPEEMKRKWQRALGEYLEKRQSLQGLVVLMDIRH PLKDLDQQMIEWAVDSNIAVLVLLTKADKLASGARKAQLNMVREAVLAFNGDVQVETFSS LKKQGVDKLRQKLDTWFSEMQPVEETQDGE |
||||
| Function |
Necessary for normal cell division and for the maintenance of normal septation. Depletion of this protein leads to a severe reduction in growth rate and to extensive filamentation, with a block beyond the stage of segregation. Essential for bacteria survivial.
|
||||
| BioCyc Pathway | |||||
Molecular Interaction Atlas (MIA) of This DTT
| Molecular Interaction Atlas (MIA) | ||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
2 Investigative Drug(s) Targeting This DTT
|
||||||||||||||||||||||||||||||||||