Details of the Drug Therapeutic Target (DTT)
General Information of Drug Therapeutic Target (DTT) (ID: TTO7014)
| DTT Name | FasL messenger RNA (FASLG mRNA) | ||||
|---|---|---|---|---|---|
| Synonyms |
Tumor necrosis factor ligand superfamily member 6 (mRNA); TNFSF6 (mRNA); FasL (mRNA); Fas ligand (mRNA); FAS antigen ligand (mRNA); CD95L (mRNA); CD95-L (mRNA); CD95 ligand (mRNA); CD178 antigen (mRNA); CD178 (mRNA); Apoptosis antigen ligand (mRNA); APTL (mRNA); APT1LG1 (mRNA)
|
||||
| Gene Name | FASLG | ||||
| DTT Type |
Literature-reported target
|
[1] | |||
| BioChemical Class |
mRNA target
|
||||
| UniProt ID | |||||
| TTD ID | |||||
| 3D Structure | |||||
| Sequence |
MQQPFNYPYPQIYWVDSSASSPWAPPGTVLPCPTSVPRRPGQRRPPPPPPPPPLPPPPPP
PPLPPLPLPPLKKRGNHSTGLCLLVMFFMVLVALVGLGLGMFQLFHLQKELAELRESTSQ MHTASSLEKQIGHPSPPPEKKELRKVAHLTGKSNSRSMPLEWEDTYGIVLLSGVKYKKGG LVINETGLYFVYSKVYFRGQSCNNLPLSHKVYMRNSKYPQDLVMMEGKMMSYCTTGQMWA RSSYLGAVFNLTSADHLYVNVSELSLVNFEESQTFFGLYKL |
||||
| Function |
Involved in cytotoxic T-cell-mediated apoptosis, natural killer cell-mediated apoptosis and in T-cell development. Initiates fratricidal/suicidal activation-induced cell death (AICD) in antigen-activated T-cells contributing to the termination of immune responses. TNFRSF6/FAS-mediated apoptosis has also a role in the induction of peripheral tolerance. Binds to TNFRSF6B/DcR3, a decoy receptor that blocks apoptosis. Cytokine that binds to TNFRSF6/FAS, a receptor that transduces the apoptotic signal into cells.
|
||||
| KEGG Pathway |
|
||||
| Reactome Pathway | |||||
Molecular Interaction Atlas (MIA) of This DTT
| Molecular Interaction Atlas (MIA) | ||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
1 Investigative Drug(s) Targeting This DTT
|
||||||||||||||||||||||||||||
