Details of the Drug Therapeutic Target (DTT)
General Information of Drug Therapeutic Target (DTT) (ID: TTP4ICS)
| DTT Name | Intestinal GlcNAc-6-sulfotransferase (CHST5) | ||||
|---|---|---|---|---|---|
| Synonyms |
N-acetylglucosamine-6-O-sulfotransferase; N-acetylglucosamine 6-O-sulfotransferase; LSST; L-selectin ligand sulfotransferase GST-3; L-selectin ligand sulfotransferase; Intestinal N-acetylglucosamine-6-O-sulfotransferase; High endothelial cell GlcNAc 6-O-sulfotransferase; HEC-GlcNAc6ST; GlcNAc 6-O-sulfotransferase; Carbohydrate sulfotransferase GST-3; CHST5
|
||||
| Gene Name | CHST5 | ||||
| DTT Type |
Literature-reported target
|
[1] | |||
| BioChemical Class |
Transferases of sulfur-containing groups
|
||||
| UniProt ID | |||||
| TTD ID | |||||
| 3D Structure | |||||
| EC Number |
EC 2.8.2.-
|
||||
| Sequence |
MGMRARVPKVAHSTRRPPAARMWLPRFSSKTVTVLLLAQTTCLLLFIISRPGPSSPAGGE
DRVHVLVLSSWRSGSSFLGQLFSQHPDVFYLMEPAWHVWTTLSQGSAATLHMAVRDLMRS IFLCDMDVFDAYMPQSRNLSAFFNWATSRALCSPPACSAFPRGTISKQDVCKTLCTRQPF SLAREACRSYSHVVLKEVRFFNLQVLYPLLSDPALNLRIVHLVRDPRAVLRSREAAGPIL ARDNGIVLGTNGKWVEADPHLRLIREVCRSHVRIAEAATLKPPPFLRGRYRLVRFEDLAR EPLAEIRALYAFTGLTLTPQLEAWIHNITHGSGIGKPIEAFHTSSRNARNVSQAWRHALP FTKILRVQEVCAGALQLLGYRPVYSADQQRDLTLDLVLPRGPDHFSWASPD |
||||
| Function |
Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor to catalyze the transfer of sulfate to position 6 of non-reducing N-acetylglucosamine (GlcNAc) residues and O-linked sugars of mucin-type acceptors. Acts on the non-reducing terminal GlcNAc of short carbohydrate substrates. However, it does not transfer sulfate to longer carbohydrate substrates that have poly-N-acetyllactosamine structures. Has no activitytoward keratan. Not involved in generating HEV-expressed ligands for SELL. Its substrate specificity may be influenced by its subcellular location.
|
||||
| Reactome Pathway | |||||
