Details of the Drug Therapeutic Target (DTT)
General Information of Drug Therapeutic Target (DTT) (ID: TTP6BIJ)
| DTT Name | Transgelin-2 (TAGLN2) | ||||
|---|---|---|---|---|---|
| Synonyms | SM22-alpha homolog; KIAA0120; Epididymis tissue protein Li 7e | ||||
| Gene Name | TAGLN2 | ||||
| DTT Type |
Literature-reported target
|
[1] | |||
| BioChemical Class |
Calponin family
|
||||
| UniProt ID | |||||
| TTD ID | |||||
| 3D Structure | |||||
| Sequence |
MANRGPAYGLSREVQQKIEKQYDADLEQILIQWITTQCRKDVGRPQPGRENFQNWLKDGT
VLCELINALYPEGQAPVKKIQASTMAFKQMEQISQFLQAAERYGINTTDIFQTVDLWEGK NMACVQRTLMNLGGLAVARDDGLFSGDPNWFPKKSKENPRNFSDNQLQEGKNVIGLQMGT NRGASQAGMTGYGMPRQIL |
||||
| Function | cytosol, extracellular exosome, extracellular region, vesicle, cadherin binding, epithelial cell differentiation, platelet degranulation. | ||||
| Reactome Pathway | |||||
