Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTQ0V86)

• DTT Name: S100 calcium-binding protein B (S100B)
• Synonyms: S-100 protein subunit beta; S-100 protein beta chain; Protein S100-B
• Gene Name: S100B
• DTT Type: Clinical trial target; [1]
• BioChemical Class: S100 calcium-binding protein
• UniProt ID: S100B_HUMAN
• TTD ID: T87206
• Sequence:
  MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMET
  LDNDGDGECDFQEFMAFVAMVTTACHEFFEHE
• Function: Physiological concentrations of potassium ion antagonize the binding of both divalent cations, especially affecting high-affinity calcium-binding sites. Binds to and initiates the activation of STK38 by releasing autoinhibitory intramolecular interactions within the kinase. Interaction with AGER after myocardial infarction may play a role in myocyte apoptosis by activating ERK1/2 and p53/TP53 signaling. Could assist ATAD3A cytoplasmic processing, preventing aggregation and favoring mitochondrial localization. May mediate calcium-dependent regulation on many physiological processes by interacting with other proteins, such as TPR-containing proteins, and modulating their activity. Weakly binds calcium but binds zinc very tightly-distinct binding sites with different affinities exist for both ions on each monomer.
• Reactome Pathway:
  TAK1-dependent IKK and NF-kappa-B activation (R-HSA-445989)
  Advanced glycosylation endproduct receptor signaling (R-HSA-879415)
  TRAF6 mediated NF-kB activation (R-HSA-933542)
  Nuclear signaling by ERBB4 (R-HSA-1251985)

Molecular Interaction Atlas (MIA) of This DTT

1 Clinical Trial Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
ONO-2506	DMCA2PJ	Stroke	8B20	Phase 2/3	[1]

References

• [1] Arundic acid (ONO-2506) ameliorates delayed ischemic brain damage by preventing astrocytic overproduction of S100B.Curr Drug Targets CNS Neurol Disord.2005 Apr;4(2):127-42.