Details of the Drug Therapeutic Target (DTT)
General Information of Drug Therapeutic Target (DTT) (ID: TTQD0YT)
| DTT Name | Alpha-endosulfine (ENSA) | ||||
|---|---|---|---|---|---|
| Synonyms | ENSA; ARPP19e | ||||
| Gene Name | ENSA | ||||
| DTT Type |
Literature-reported target
|
[1] | |||
| BioChemical Class |
Endosulfine family
|
||||
| UniProt ID | |||||
| TTD ID | |||||
| 3D Structure | |||||
| Sequence |
MSQKQEEENPAEETGEEKQDTQEKEGILPERAEEAKLKAKYPSLGQKPGGSDFLMKRLQK
GQKYFDSGDYNMAKAKMKNKQLPSAGPDKNLVTGDHIPTPQDLPQRKSSLVTSKLAGGQV E |
||||
| Function | Endogenous ligand for sulfonylurea receptor. By inhibitingsulfonylurea from binding to the receptor, it reduces k(atp) channel currents and thereby stimulates insulin secretion. | ||||
| Reactome Pathway | |||||
