Details of the Drug Therapeutic Target (DTT)
General Information of Drug Therapeutic Target (DTT) (ID: TTQNRJM)
| DTT Name | Natural cytotoxic triggering receptor 1 (NCR1) | ||||
|---|---|---|---|---|---|
| Synonyms | hNKp46; Natural killer cell p46-related protein; Natural cytotoxicity triggering receptor 1; NKp46; NK-p46; NK cell-activating receptor; Lymphocyte antigen 94 homolog; LY94; CD335 | ||||
| Gene Name | NCR1 | ||||
| DTT Type |
Literature-reported target
|
[1] | |||
| UniProt ID | |||||
| TTD ID | |||||
| 3D Structure | |||||
| Sequence |
MSSTLPALLCVGLCLSQRISAQQQTLPKPFIWAEPHFMVPKEKQVTICCQGNYGAVEYQL
HFEGSLFAVDRPKPPERINKVKFYIPDMNSRMAGQYSCIYRVGELWSEPSNLLDLVVTEM YDTPTLSVHPGPEVISGEKVTFYCRLDTATSMFLLLKEGRSSHVQRGYGKVQAEFPLGPV TTAHRGTYRCFGSYNNHAWSFPSEPVKLLVTGDIENTSLAPEDPTFPADTWGTYLLTTET GLQKDHALWDHTAQNLLRMGLAFLVLVALVWFLVEDWLSRKRTRERASRASTWEGRRRLN TQTL |
||||
| Function | Cytotoxicity-activating receptor that may contribute to the increased efficiency of activated natural killer (NK) cells to mediate tumor cell lysis. | ||||
| KEGG Pathway | |||||
| Reactome Pathway | |||||
Molecular Interaction Atlas (MIA) of This DTT
| Molecular Interaction Atlas (MIA) | ||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
1 Clinical Trial Drug(s) Targeting This DTT
|
||||||||||||||||||||||||||||
