Details of the Drug Therapeutic Target (DTT)
General Information of Drug Therapeutic Target (DTT) (ID: TTQOVYA)
| DTT Name | C-X-C motif chemokine 10 (CXCL10) | ||||
|---|---|---|---|---|---|
| Synonyms | Small-inducible cytokine B10; SCYB10; IP-10; INP10; Gamma-IP10; 10 kDa interferon gamma-induced protein | ||||
| Gene Name | CXCL10 | ||||
| DTT Type | 
                     Clinical trial target 
                 | 
                [1] | |||
| BioChemical Class | 
                     Cytokine: CXC chemokine 
                 | 
            ||||
| UniProt ID | |||||
| TTD ID | |||||
| 3D Structure | |||||
| Sequence | 
                                         
                        MNQTAILICCLIFLTLSGIQGVPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRV 
                    
                EIIATMKKKGEKRCLNPESKAIKNLLKAVSKERSKRSP  | 
            ||||
| Function | 
                                         
                        Pro-inflammatory cytokine that is involved in a wide variety of processes such as chemotaxis, differentiation, and activation of peripheral immune cells, regulation of cell growth, apoptosis and modulation of angiostatic effects. Plays thereby an important role during viral infections by stimulating the activation and migration of immune cells to the infected sites (By similarity). Mechanistically, binding of CXCL10 to the CXCR3 receptor activates G protein-mediated signaling and results in downstream activation of phospholipase C-dependent pathway, an increase in intracellular calcium production and actin reorganization. In turn, recruitment of activated Th1 lymphocytes occurs at sites of inflammation. Activation of the CXCL10/CXCR3 axis plays also an important role in neurons in response to brain injury for activating microglia, the resident macrophage population of the central nervous system, and directing them to the lesion site. This recruitment is an essential element for neuronal reorganization (By similarity).
                        
                     
                                     | 
            ||||
| KEGG Pathway | |||||
| Reactome Pathway | |||||
Molecular Interaction Atlas (MIA) of This DTT
| Molecular Interaction Atlas (MIA) | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| 
                     6 Clinical Trial Drug(s) Targeting This DTT 
                                        
  | 
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| 
                     1 Investigative Drug(s) Targeting This DTT 
                                            
  | 
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
References
