Details of the Drug Therapeutic Target (DTT)
General Information of Drug Therapeutic Target (DTT) (ID: TTRF4Q2)
| DTT Name | Interferon-lambda 3 (IFNL3) | ||||
|---|---|---|---|---|---|
| Synonyms | ZCYTO22; Interleukin28C; Interleukin28B; Interleukin-28C; Interleukin-28B; Interferon lambda3; Interferon lambda-3; IL28C; IL28B; IL-28C; IL-28B; IFNlambda3; IFN-lambda-3; Cytokine Zcyto22 | ||||
| Gene Name | IFNL3 | ||||
| DTT Type |
Literature-reported target
|
[1] | |||
| BioChemical Class |
Cytokine: interferon
|
||||
| UniProt ID | |||||
| TTD ID | |||||
| 3D Structure | |||||
| Sequence |
MTGDCMPVLVLMAAVLTVTGAVPVARLRGALPDARGCHIAQFKSLSPQELQAFKRAKDAL
EESLLLKDCKCRSRLFPRTWDLRQLQVRERPVALEAELALTLKVLEATADTDPALGDVLD QPLHTLHHILSQLRACIQPQPTAGPRTRGRLHHWLHRLQEAPKKESPGCLEASVTFNLFR LLTRDLNCVASGDLCV |
||||
| Function |
Plays a critical role in the antiviral host defense, predominantly in the epithelial tissues. Acts as a ligand for the heterodimeric class II cytokine receptor composed of IL10RB and IFNLR1, and receptor engagement leads to the activation of the JAK/STAT signaling pathway resulting in the expression of IFN-stimulated genes (ISG), which mediate the antiviral state. Has a restricted receptor distribution and therefore restricted targets: is primarily active in epithelial cells and this cell type-selective action is because of the epithelial cell-specific expression of its receptor IFNLR1. Seems not to be essential for early virus-activated host defense in vaginal infection, but plays an important role in Toll-like receptor (TLR)-induced antiviral defense. Plays a significant role in the antiviral immune defense in the intestinal epithelium. Exerts an immunomodulatory effect by up-regulating MHC class I antigen expression. Cytokine with antiviral, antitumour and immunomodulatory activities.
|
||||
| KEGG Pathway | |||||
| Reactome Pathway | |||||
