Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTRHEQ4)

DTT Name	Diacylglycerol O-acyltransferase 2 (DGAT2)
Synonyms	UNQ738/PRO1433; HMFN1045; Diglyceride acyltransferase 2
Gene Name	DGAT2
DTT Type	Successful target	[1]
BioChemical Class	Acyltransferase
UniProt ID	DGAT2_HUMAN
TTD ID	T95558
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
EC Number	EC 2.3.1.20
Sequence	MKTLIAAYSGVLRGERQAEADRSQRSHGGPALSREGSGRWGTGSSILSALQDLFSVTWLN RSKVEKQLQVISVLQWVLSFLVLGVACSAILMYIFCTDCWLIAVLYFTWLVFDWNTPKKG GRRSQWVRNWAVWRYFRDYFPIQLVKTHNLLTTRNYIFGYHPHGIMGLGAFCNFSTEATE VSKKFPGIRPYLATLAGNFRMPVLREYLMSGGICPVSRDTIDYLLSKNGSGNAIIIVVGG AAESLSSMPGKNAVTLRNRKGFVKLALRHGADLVPIYSFGENEVYKQVIFEEGSWGRWVQ KKFQKYIGFAPCIFHGRGLFSSDTWGLVPYSKPITTVVGEPITIPKLEHPTQQDIDLYHT MYMEALVKLFDKHKTKFGLPETEVLEVN
Function	Required for synthesis and storage of intracellular triglycerides. Probably plays a central role in cytosolic lipid accumulation. In liver, is primarily responsible for incorporating endogenously synthesized fatty acids into triglycerides. Functions also as an acyl-CoA retinol acyltransferase (ARAT). Essential acyltransferase that catalyzes the terminal and only committed step in triacylglycerol synthesis by using diacylglycerol and fatty acyl CoA as substrates.
KEGG Pathway	Glycerolipid metabolism (hsa00561 ) Metabolic pathways (hsa01100 ) Fat digestion and absorption (hsa04975 )
Reactome Pathway	Triglyceride Biosynthesis (R-HSA-75109 ) Acyl chain remodeling of DAG and TAG (R-HSA-1482883 )

Molecular Interaction Atlas (MIA) of This DTT

Molecular Interaction Atlas (MIA)

Jump to Detail Molecular Interaction Atlas of This DTT

1 Approved Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Vitamin B3	DMQVRZH	Chronic renal failure	GB61.Z	Approved	[1]
------------------------------------------------------------------------------------

3 Clinical Trial Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
ARI-3037MO	DM9LNXS	Cardiovascular disease	BA00-BE2Z	Phase 2	[2]
PF-06865571	DMZE3GK	Non-alcoholic steatohepatitis	DB92.1	Phase 2	[3]
PF-06427878	DMGB32Z	Cardiovascular disease	BA00-BE2Z	Phase 1	[4]
------------------------------------------------------------------------------------

2 Patented Agent(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
PMID25470667-Compound-Figure4-1A	DMMVQW8	N. A.	N. A.	Patented	[5]
PMID25470667-Compound-roselipins	DMCF2G7	N. A.	N. A.	Patented	[5]
------------------------------------------------------------------------------------

References

1	Hakozaki T, Minwalla L, Zhuang J, Chhoa M, Matsubara A, Miyamoto K, Greatens A, Hillebrand GG, Bissett DL, Boissy RE: The effect of niacinamide on reducing cutaneous pigmentation and suppression of melanosome transfer. Br J Dermatol. 2002 Jul;147(1):20-31.
2	2011 Pipeline of Arisaph Pharmaceuticals.
3	Discovery of Ervogastat (PF-06865571): A Potent and Selective Inhibitor of Diacylglycerol Acyltransferase 2 for the Treatment of Non-alcoholic Steatohepatitis. J Med Chem. 2022 Nov 24;65(22):15000-15013.
4	Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA)
5	Acyltransferase inhibitors: a patent review (2010-present).Expert Opin Ther Pat. 2015 Feb;25(2):145-58.