Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTRTK6Y)

• DTT Name: Interleukin-12 alpha (IL12A)
• Synonyms: NKSF1; NKSF; NK cell stimulatory factor chain 1; NK cell stimulatory factor; Interleukin-12 subunit alpha; IL-12A; IL-12 subunit p35; IL-12; Cytotoxic lymphocyte maturation factor 35 kDa subunit; CLMF p35
• Gene Name: IL12A
• DTT Type: Successful target; [1]
• BioChemical Class: Cytokine: interleukin
• UniProt ID: IL12A_HUMAN
• TTD ID: T13251
• Sequence:
  MCPARSLLLVATLVLLDHLSLARNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLE
  FYPCTSEEIDHEDITKDKTSTVEACLPLELTKNESCLNSRETSFITNGSCLASRKTSFMM
  ALCLSSIYEDLKMYQVEFKTMNAKLLMDPKRQIFLDQNMLAVIDELMQALNFNSETVPQK
  SSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLNAS
• Function: Cytokine that can act as a growth factor for activated T and NK cells, enhance the lytic activity of NK/lymphokine-activated killer cells, and stimulate the production of IFN-gamma by resting PBMC.
• KEGG Pathway:
  Cytokine-cytokine receptor interaction (hsa04060)
  Toll-like receptor signaling pathway (hsa04620)
  RIG-I-like receptor signaling pathway (hsa04622)
  Jak-STAT signaling pathway (hsa04630)
  Type I diabetes mellitus (hsa04940)
  Pertussis (hsa05133)
  Legionellosis (hsa05134)
  Leishmaniasis (hsa05140)
  Chagas disease (American trypanosomiasis) (hsa05142)
  African trypanosomiasis (hsa05143)
  Malaria (hsa05144)
  Toxoplasmosis (hsa05145)
  Amoebiasis (hsa05146)
  Tuberculosis (hsa05152)
  Measles (hsa05162)
  Influenza A (hsa05164)
  Herpes simplex infection (hsa05168)
  Inflammatory bowel disease (IBD) (hsa05321)
  Allograft rejection (hsa05330)
• Reactome Pathway:
  Interleukin-4 and Interleukin-13 signaling (R-HSA-6785807)
  Interleukin-35 Signalling (R-HSA-8984722)
  Interleukin-12 signaling (R-HSA-9020591)
  Interleukin-10 signaling (R-HSA-6783783)

Molecular Interaction Atlas (MIA) of This DTT

2 Approved Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Mirikizumab	DM7R3N5	Ulcerative colitis	DD71	Approved	[2]
Ustekinumab	DMHTYK3	Plaque psoriasis	EA90.0	Approved	[1]

1 Clinical Trial Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
STA-5326	DMH4C3M	Crohn disease	DD70	Phase 2	[3]

Molecular Expression Atlas (MEA) of This DTT

Disease Name	ICD 11	Studied Tissue	p-value	Fold-Change	Z-score
Rheumatoid arthritis	FA20	Synovial tissue	1.65E-05	-0.11	-0.64
Psoriasis	EA90	Skin	9.78E-06	-0.1	-0.4
Ovarian cancer	2C82	Ovarian tissue	2.40E-03	0.29	1
Breast cancer	2C82	Breast tissue	2.41E-04	-0.12	-0.49
Melanoma	2C82	Skin	1.08E-01	0.13	0.17

References

• [1] Hughes B: 2009 FDA drug approvals. Nat Rev Drug Discov. 2010 Feb;9(2):89-92.
• [2] Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA)
• [3] Therapeutic effect of the potent IL-12/IL-23 inhibitor STA-5326 on experimental autoimmune uveoretinitis. Arthritis Res Ther. 2008;10(5):R122.