Details of the Drug Therapeutic Target (DTT)
General Information of Drug Therapeutic Target (DTT) (ID: TTS2TGF)
| DTT Name | Interferon-omega (IFNW1) | ||||
|---|---|---|---|---|---|
| Synonyms | Interferon omega1; Interferon omega-1; Interferon alphaII1; Interferon alpha-II-1 | ||||
| Gene Name | IFNW1 | ||||
| DTT Type |
Clinical trial target
|
[1] | |||
| BioChemical Class |
Cytokine: interferon
|
||||
| UniProt ID | |||||
| TTD ID | |||||
| 3D Structure | |||||
| Sequence |
MALLFPLLAALVMTSYSPVGSLGCDLPQNHGLLSRNTLVLLHQMRRISPFLCLKDRRDFR
FPQEMVKGSQLQKAHVMSVLHEMLQQIFSLFHTERSSAAWNMTLLDQLHTGLHQQLQHLE TCLLQVVGEGESAGAISSPALTLRRYFQGIRVYLKEKKYSDCAWEVVRMEIMKSLFLSTN MQERLRSKDRDLGSS |
||||
| Function |
extracellular space, cytokine activity, cytokine receptor binding, type I interferon receptor binding, adaptive immune response, B cell differentiation, B cell proliferation, cell cycle arrest, cytokine-mediated signaling pathway, humoral immune response.
|
||||
| KEGG Pathway | |||||
Molecular Interaction Atlas (MIA) of This DTT
| Molecular Interaction Atlas (MIA) | ||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
1 Clinical Trial Drug(s) Targeting This DTT
|
||||||||||||||||||||||||||||
