Details of the Drug Therapeutic Target (DTT)
General Information of Drug Therapeutic Target (DTT) (ID: TTSECX1)
| DTT Name | Connective tissue growth factor (CTGF) | ||||
|---|---|---|---|---|---|
| Synonyms | Long; Insulin-like growth factor-binding protein 8; IGFBP8; IGFBP-8; IGF-binding protein 8; IBP-8; Hypertrophic chondrocyte-specific protein 24; HCS24; CCN2; CCN family member 2 | ||||
| Gene Name | CTGF | ||||
| DTT Type | 
                     Clinical trial target 
                 | 
                [1] | |||
| UniProt ID | |||||
| TTD ID | |||||
| Sequence | 
                                         
                            MTAASMGPVRVAFVVLLALCSRPAVGQNCSGPCRCPDEPAPRCPAGVSLVLDGCGCCRVC 
                        
                    AKQLGELCTERDPCDPHKGLFCHFGSPANRKIGVCTAKDGAPCIFGGTVYRSGESFQSSC KYQCTCLDGAVGCMPLCSMDVRLPSPDCPFPRRVKLPGKCCEEWVCDEPKDQTVVGPALA AYRLEDTFGPDPTMIRANCLVQTTEWSACSKTCGMGISTRVTNDNASCRLEKQSRLCMVR PCEADLEENIKKGKKCIRTPKISKPIKFELSGCTSMKTYRAKFCGVCTDGRCCTPHRTTT LPVEFKCPDGEVMKKNMMFIKTCACHYNCPGDNDIFESLYYRKMYGDMA  | 
            ||||
| Function | 
                                         
                        Promotes proliferation and differentiation of chondrocytes. Mediates heparin- and divalent cation-dependent cell adhesion in many cell types including fibroblasts, myofibroblasts, endothelial and epithelial cells. Enhances fibroblast growth factor-induced DNA synthesis. Major connective tissue mitoattractant secreted by vascular endothelial cells.
                        
                     
                                     | 
            ||||
| KEGG Pathway | |||||
| Reactome Pathway | |||||
Molecular Interaction Atlas (MIA) of This DTT
| Molecular Interaction Atlas (MIA) | ||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| 
                     1 Clinical Trial Drug(s) Targeting This DTT 
                                            
  | 
            ||||||||||||||||||||||||||||
Molecular Expression Atlas (MEA) of This DTT
