Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTSG7Q5)

• DTT Name: Platelet factor 4 (PF4)
• Synonyms: PF-4; C-X-C motif chemokine 4; Iroplact; Oncostatin-A
• Gene Name: PF4
• DTT Type: Clinical trial target; [1]
• UniProt ID: PLF4_HUMAN
• TTD ID: T30827
• Sequence:
  MSSAAGFCASRPGLLFLGLLLLPLVVAFASAEAEEDGDLQCLCVKTTSQVRPRHITSLEV
  IKAGPHCPTAQLIATLKNGRKICLDLQAPLYKKIIKKLLES
• Function: Released during platelet aggregation. Neutralizes the anticoagulant effect of heparin because it binds more strongly to heparin than to the chondroitin-4-sulfate chains of the carrier molecule. Chemotactic for neutrophils and monocytes. Inhibits endothelial cell proliferation, the short form is a more potent inhibitor than the longer form.
• KEGG Pathway:
  Cytokine-cytokine receptor interaction (hsa04060)
  Viral protein interaction with cytokine and cytokine receptor (hsa04061)
  Chemokine signaling pathway (hsa04062)
• Reactome Pathway:
  Common Pathway of Fibrin Clot Formation (R-HSA-140875)
  Cell surface interactions at the vascular wall (R-HSA-202733)
  Chemokine receptors bind chemokines (R-HSA-380108)
  G alpha (i) signalling events (R-HSA-418594)
  RUNX1 regulates genes involved in megakaryocyte differentiation and platelet function (R-HSA-8936459)
  Platelet degranulation (R-HSA-114608)

Molecular Interaction Atlas (MIA) of This DTT

1 Clinical Trial Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Dociparstat sodium	DMQLSMB	Acute myeloid leukaemia	2A60	Phase 3	[1]

References

• [1] Clinical pipeline report, company report or official report of Chimerix.