Details of the Drug Therapeutic Target (DTT)
General Information of Drug Therapeutic Target (DTT) (ID: TTSGLN5)
| DTT Name | Neuromodulin (GAP43) | ||||
|---|---|---|---|---|---|
| Synonyms | pp46; Neural phosphoprotein B-50; Growth-associated protein 43; Axonal membrane protein GAP-43 | ||||
| Gene Name | GAP43 | ||||
| DTT Type |
Literature-reported target
|
[1] | |||
| BioChemical Class |
Neuromodulin family
|
||||
| UniProt ID | |||||
| TTD ID | |||||
| 3D Structure | |||||
| Sequence |
MLCCMRRTKQVEKNDDDQKIEQDGIKPEDKAHKAATKIQASFRGHITRKKLKGEKKDDVQ
AAEAEANKKDEAPVADGVEKKGEGTTTAEAAPATGSKPDEPGKAGETPSEEKKGEGDAAT EQAAPQAPASSEEKAGSAETESATKASTDNSPSSKAEDAPAKEEPKQADVPAAVTAAAAT TPAAEDAAAKATAQPPTETGESSQAEENIEAVDETKPKESARQDEGKEEEPEADQEHA |
||||
| Function | This protein is associated with nerve growth. It is a major component of the motile "growth cones" that form the tips of elongating axons. Plays a role in axonal and dendritic filopodia induction. | ||||
| Reactome Pathway | |||||