Details of the Drug Therapeutic Target (DTT)
General Information of Drug Therapeutic Target (DTT) (ID: TTSJ9E7)
DTT Name | Short transient receptor potential channel 2 (TRPC2) | ||||
---|---|---|---|---|---|
Synonyms | Uncharacterized protein | ||||
Gene Name | TRPC2 | ||||
DTT Type |
Literature-reported target
|
[1] | |||
BioChemical Class |
Transient receptor potential catioin channel
|
||||
UniProt ID | |||||
TTD ID | |||||
Sequence |
SCACLECSNARRYDLLKLSLSRINTYLGIASRAHLSLASEDAMLAAFQLSRELRRLARKE
PEFKPEYIALESLSQDYGFQLLGMCWNQSEVTAVLNDLAEDSETEPEAEGLGLAFEEGIP SLVRPRLAVNYNQKRFVAHLICQQVLSSI |
||||
Function | Has calcium channel activity. | ||||
Molecular Interaction Atlas (MIA) of This DTT
Molecular Interaction Atlas (MIA) | ||||||||||||||||||||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
3 Investigative Drug(s) Targeting This DTT
|
||||||||||||||||||||||||||||||||||||||||