Details of the Drug Therapeutic Target (DTT)
General Information of Drug Therapeutic Target (DTT) (ID: TTT9MRQ)
| DTT Name | Cell surface protein HB15 (CD83) | ||||
|---|---|---|---|---|---|
| Synonyms | hCD83; CD83 antigen; Bcell activation protein; B-cell activation protein | ||||
| Gene Name | CD83 | ||||
| DTT Type |
Literature-reported target
|
[1] | |||
| BioChemical Class |
Immunoglobulin
|
||||
| UniProt ID | |||||
| TTD ID | |||||
| 3D Structure | |||||
| Sequence |
MSRGLQLLLLSCAYSLAPATPEVKVACSEDVDLPCTAPWDPQVPYTVSWVKLLEGGEERM
ETPQEDHLRGQHYHQKGQNGSFDAPNERPYSLKIRNTTSCNSGTYRCTLQDPDGQRNLSG KVILRVTGCPAQRKEETFKKYRAEIVLLLALVIFYLTLIIFTCKFARLQSIFPDFSKAGM ERAFLPVTSPNKHLGLVTPHKTELV |
||||
| Function | May play a significant role in antigen presentation or the cellular interactions that follow lymphocyte activation. | ||||
