Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTTJZ4M)

• DTT Name: Prolylcarboxypeptidase (PRCP)
• Synonyms: Proline carboxypeptidase; PCP; Lysosomal carboxypeptidase C; Lysosomal Pro-X carboxypeptidase; Angiotensinase C
• Gene Name: PRCP
• DTT Type: Patented-recorded target; [1]
• BioChemical Class: Peptidase
• UniProt ID: PCP_HUMAN
• TTD ID: T20371
• EC Number: EC 3.4.16.2
• Sequence:
  MGRRALLLLLLSFLAPWATIALRPALRALGSLHLPTNPTSLPAVAKNYSVLYFQQKVDHF
  GFNTVKTFNQRYLVADKYWKKNGGSILFYTGNEGDIIWFCNNTGFMWDVAEELKAMLVFA
  EHRYYGESLPFGDNSFKDSRHLNFLTSEQALADFAELIKHLKRTIPGAENQPVIAIGGSY
  GGMLAAWFRMKYPHMVVGALAASAPIWQFEDLVPCGVFMKIVTTDFRKSGPHCSESIHRS
  WDAINRLSNTGSGLQWLTGALHLCSPLTSQDIQHLKDWISETWVNLAMVDYPYASNFLQP
  LPAWPIKVVCQYLKNPNVSDSLLLQNIFQALNVYYNYSGQVKCLNISETATSSLGTLGWS
  YQACTEVVMPFCTNGVDDMFEPHSWNLKELSDDCFQQWGVRPRPSWITTMYGGKNISSHT
  NIVFSNGELDPWSGGGVTKDITDTLVAVTISEGAHHLDLRTKNALDPMSVLLARSLEVRH
  MKNWIRDFYDSAGKQH
• Function: Cleaves C-terminal amino acids linked to proline in peptides such as angiotensin II, III and des-Arg9-bradykinin. This cleavage occurs at acidic pH, but enzymatic activity is retained with some substrates at neutral pH.
• KEGG Pathway:
  Renin-angiotensin system (hsa04614)
  Protein digestion and absorption (hsa04974)
• Reactome Pathway:
  Neutrophil degranulation (R-HSA-6798695)
  Intrinsic Pathway of Fibrin Clot Formation (R-HSA-140837)

Molecular Interaction Atlas (MIA) of This DTT

23 Patented Agent(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Benzodihydroisofuran derivative 1	DM249KU	N. A.	N. A.	Patented	[1]
Benzodihydroisofuran derivative 2	DMGK0FD	N. A.	N. A.	Patented	[1]
Benzodihydroisofuran derivative 3	DMF6B1I	N. A.	N. A.	Patented	[1]
Benzodihydroisofuran derivative 4	DM5IH2O	N. A.	N. A.	Patented	[1]
Cyclohexane carboxamide derivative 1	DMN3WID	N. A.	N. A.	Patented	[1]
Cyclohexane carboxamide derivative 2	DM1A0WU	N. A.	N. A.	Patented	[1]
Cyclohexane carboxamide derivative 3	DMQLZUW	N. A.	N. A.	Patented	[1]
Cyclopentane carboxamide derivative 1	DMH7PGC	N. A.	N. A.	Patented	[1]
Cyclopentane carboxamide derivative 2	DMYP5FK	N. A.	N. A.	Patented	[1]
Imidazole derivative 8	DMK9P7S	N. A.	N. A.	Patented	[1]
Imidazole derivative 9	DMSV42L	N. A.	N. A.	Patented	[1]
Piperidinyl pyrazole derivative 1	DMWAYXP	N. A.	N. A.	Patented	[1]
Piperidinyl pyrazole derivative 2	DM21S5G	N. A.	N. A.	Patented	[1]
Piperidinyl pyrazole derivative 3	DMX2V0W	N. A.	N. A.	Patented	[1]
Piperidinyl pyrazole derivative 4	DMS8NFJ	N. A.	N. A.	Patented	[1]
Piperidinyl triazole derivative 1	DMTSX7J	N. A.	N. A.	Patented	[1]
Piperidinyl triazole derivative 2	DM2FZPE	N. A.	N. A.	Patented	[1]
Piperidinyl triazole derivative 3	DM0J2TE	N. A.	N. A.	Patented	[1]
Piperidinyl triazole derivative 4	DMOQJMU	N. A.	N. A.	Patented	[1]
Piperidinyl triazole derivative 5	DM4QVD0	N. A.	N. A.	Patented	[1]
Piperidinyl triazole derivative 6	DMG5HI1	N. A.	N. A.	Patented	[1]
Proline amide derivative 1	DMH2AYV	N. A.	N. A.	Patented	[1]
Pyrrolidine carboxamide derivative 2	DMKDX6W	N. A.	N. A.	Patented	[1]

1 Investigative Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
PMID24157366C35	DMWUZP1	Discovery agent	N.A.	Investigative	[2]

References

• [1] Prolylcarboxypeptidase (PrCP) inhibitors and the therapeutic uses thereof: a patent review.Expert Opin Ther Pat. 2017 Oct;27(10):1077-1088.
• [2] Discovery and optimization of orally active cyclohexane-based prolylcarboxypeptidase (PrCP) inhibitors. Bioorg Med Chem Lett. 2013 Dec 1;23(23):6228-33.