Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTU3Y87)

• DTT Name: CCR3 messenger RNA (CCR3 mRNA)
• Synonyms: Eosinophil eotaxin receptor (mRNA); Chemokine receptor CCR3 (mRNA); CMKBR3 (mRNA); CKR3 (mRNA); CD193 (mRNA); CCR-3 (mRNA); CC-CKR-3 (mRNA); C-C chemokine receptor type 3 (mRNA); C-C CKR-3 (mRNA)
• Gene Name: CCR3
• DTT Type: Clinical trial target; [1]
• BioChemical Class: mRNA target
• UniProt ID: CCR3_HUMAN
• TTD ID: T85228
• Sequence:
  MTTSLDTVETFGTTSYYDDVGLLCEKADTRALMAQFVPPLYSLVFTVGLLGNVVVVMILI
  KYRRLRIMTNIYLLNLAISDLLFLVTLPFWIHYVRGHNWVFGHGMCKLLSGFYHTGLYSE
  IFFIILLTIDRYLAIVHAVFALRARTVTFGVITSIVTWGLAVLAALPEFIFYETEELFEE
  TLCSALYPEDTVYSWRHFHTLRMTIFCLVLPLLVMAICYTGIIKTLLRCPSKKKYKAIRL
  IFVIMAVFFIFWTPYNVAILLSSYQSILFGNDCERSKHLDLVMLVTEVIAYSHCCMNPVI
  YAFVGERFRKYLRHFFHRHLLMHLGRYIPFLPSEKLERTSSVSPSTAEPELSIVF
• Function: Binds to eotaxin, eotaxin-3, MCP-3, MCP-4, RANTES and MIP-1 delta. Subsequently transduces a signal by increasing the intracellular calcium ions level. Alternative coreceptor with CD4 for HIV-1 infection. Receptor for a C-C type chemokine.
• KEGG Pathway:
  Cytokine-cytokine receptor interaction (hsa04060)
  Viral protein interaction with cytokine and cytokine receptor (hsa04061)
  Chemokine signaling pathway (hsa04062)
  Human cytomegalovirus infection (hsa05163)
  Kaposi sarcoma-associated herpesvirus infection (hsa05167)
  Viral carcinogenesis (hsa05203)
• Reactome Pathway:
  G alpha (i) signalling events (R-HSA-418594)
  Chemokine receptors bind chemokines (R-HSA-380108)

Molecular Interaction Atlas (MIA) of This DTT

1 Clinical Trial Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
ASM8	DMTHR4U	Allergic asthma	CA23.0	Phase 2	[1]

5 Investigative Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
banyu (I)	DM9JXIZ	Discovery agent	N.A.	Investigative	[2]
RO116-4875/608	DMFTW0U	Discovery agent	N.A.	Investigative	[3]
RO116-9132/238	DM6XM1D	Discovery agent	N.A.	Investigative	[3]
RO320-2947/001	DM8BLYO	Discovery agent	N.A.	Investigative	[3]
RO330-0802/001	DMGOPY1	Discovery agent	N.A.	Investigative	[3]

Molecular Expression Atlas (MEA) of This DTT

Disease Name	ICD 11	Studied Tissue	p-value	Fold-Change	Z-score
Asthma	CA23	Nasal and bronchial airway	3.77E-02	-0.01	-0.04

References

• [1] URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 60).
• [2] Identification of full, partial and inverse CC chemokine receptor 3 agonists using [35S]GTPgammaS binding. Eur J Pharmacol. 2002 Dec 5;456(1-3):1-10.
• [3] Responses of leukocytes to chemokines in whole blood and their antagonism by novel CC-chemokine receptor 3 antagonists. Am J Respir Crit Care Med. 2002 Jun 15;165(12):1602-9.