Details of the Drug Therapeutic Target (DTT)
General Information of Drug Therapeutic Target (DTT) (ID: TTUH273)
DTT Name | Choriogonadotropin beta (CG-beta) | ||||
---|---|---|---|---|---|
Synonyms | Chorionic gonadotropin beta subunit; Chorionic gonadotrophin beta subunit; CG-beta | ||||
Gene Name | CGB3 | ||||
DTT Type |
Clinical trial target
|
[1] | |||
BioChemical Class |
Hormone
|
||||
UniProt ID | |||||
TTD ID | |||||
3D Structure | |||||
Sequence |
MEMFQGLLLLLLLSMGGTWASKEPLRPRCRPINATLAVEKEGCPVCITVNTTICAGYCPT
MTRVLQGVLPALPQVVCNYRDVRFESIRLPGCPRGVNPVVSYAVALSCQCALCRRSTTDC GGPKDHPLTCDDPRFQDSSSSKAPPPSLPSPSRLPGPSDTPILPQ |
||||
Function | Stimulates the ovaries to synthesize the steroids that are essential for the maintenance of pregnancy. | ||||
Reactome Pathway | |||||
Molecular Interaction Atlas (MIA) of This DTT
Molecular Interaction Atlas (MIA) | ||||||||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
1 Clinical Trial Drug(s) Targeting This DTT
|
||||||||||||||||||||||||||||