Details of the Drug Therapeutic Target (DTT)
General Information of Drug Therapeutic Target (DTT) (ID: TTUZ9GV)
| DTT Name | Calcitonin gene-related peptide 2 (CALCB) | ||||
|---|---|---|---|---|---|
| Synonyms | Calcitonin gene-related peptide II; CGRP-II; CALC2; Beta-type CGRP; Beta-CGRP | ||||
| Gene Name | CALCB | ||||
| DTT Type |
Literature-reported target
|
[1] | |||
| UniProt ID | |||||
| TTD ID | |||||
| 3D Structure | |||||
| Sequence |
MGFRKFSPFLALSILVLYQAGSLQAAPFRSALESSPDPATLSKEDARLLLAALVQDYVQM
KASELKQEQETQGSSSAAQKRACNTATCVTHRLAGLLSRSGGMVKSNFVPTNVGSKAFGR RRRDLQA |
||||
| Function |
CGRP induces vasodilation. It dilates a variety of vessels including the coronary, cerebral and systemic vasculature. Its abundance in the CNS also points toward a neurotransmitter or neuromodulator role.
|
||||
| KEGG Pathway | |||||
| Reactome Pathway | |||||