| DTT Name |
HUMAN protein kinase cAMP-activated catalytic subunit alpha (PRKACA)
|
| Synonyms |
PKA C-alpha; cAMP-dependent protein kinase catalytic subunit alpha |
| Gene Name |
PRKACA
|
| BioChemical Class |
Kinase
|
| UniProt ID |
|
| TTD ID |
|
| 3D Structure |
|
| EC Number |
EC 2.7.11.11
|
| Sequence |
MGNAAAAKKGSEQESVKEFLAKAKEDFLKKWESPAQNTAHLDQFERIKTLGTGSFGRVML
VKHKETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMV
MEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGY
IQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFF
ADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFAT
TDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVSINEKCGKEFSEF
|
| Function |
Human protein protein kinase cAMP-activated catalytic subunit alpha interacts with SARS-CoV-2 Nsp13 protein with high significance, which indicates PRKACA as a potential therapeutic target. |
| KEGG Pathway |
- Endocrine resistance (hsa01522 )
- MAPK signaling pathway (hsa04010 )
- Ras signaling pathway (hsa04014 )
- Calcium signaling pathway (hsa04020 )
- cAMP signaling pathway (hsa04024 )
- Chemokine signaling pathway (hsa04062 )
- Oocyte meiosis (hsa04114 )
- Autophagy - animal (hsa04140 )
- Longevity regulating pathway (hsa04211 )
- Longevity regulating pathway - multiple species (hsa04213 )
- Adrenergic signaling in cardiomyocytes (hsa04261 )
- Vascular smooth muscle contraction (hsa04270 )
- Wnt signaling pathway (hsa04310 )
- Hedgehog signaling pathway (hsa04340 )
- Apelin signaling pathway (hsa04371 )
- Tight junction (hsa04530 )
- Gap junction (hsa04540 )
- Platelet activation (hsa04611 )
- Circadian entrainment (hsa04713 )
- Thermogenesis (hsa04714 )
- Long-term potentiation (hsa04720 )
- Retrograde endocannabinoid signaling (hsa04723 )
- Glutamatergic synapse (hsa04724 )
- Cholinergic synapse (hsa04725 )
- Serotonergic synapse (hsa04726 )
- GABAergic synapse (hsa04727 )
- Dopaminergic synapse (hsa04728 )
- Olfactory transduction (hsa04740 )
- Taste transduction (hsa04742 )
- Inflammatory mediator regulation of TRP channels (hsa04750 )
- Insulin signaling pathway (hsa04910 )
- Insulin secretion (hsa04911 )
- GnRH signaling pathway (hsa04912 )
- Ovarian steroidogenesis (hsa04913 )
- Progesterone-mediated oocyte maturation (hsa04914 )
- Estrogen signaling pathway (hsa04915 )
- Melanogenesis (hsa04916 )
- Thyroid hormone synthesis (hsa04918 )
- Thyroid hormone signaling pathway (hsa04919 )
- Oxytocin signaling pathway (hsa04921 )
- Glucagon signaling pathway (hsa04922 )
- Regulation of lipolysis in adipocytes (hsa04923 )
- Renin secretion (hsa04924 )
- Aldosterone synthesis and secretion (hsa04925 )
- Relaxin signaling pathway (hsa04926 )
- Cortisol synthesis and secretion (hsa04927 )
- Parathyroid hormone synthesis, secretion and action (hsa04928 )
- Cushing syndrome (hsa04934 )
- Growth hormone synthesis, secretion and action (hsa04935 )
- Endocrine and other factor-regulated calcium reabsorption (hsa04961 )
- Vasopressin-regulated water reabsorption (hsa04962 )
- Salivary secretion (hsa04970 )
- Gastric acid secretion (hsa04971 )
- Bile secretion (hsa04976 )
- Parkinson disease (hsa05012 )
- Prion disease (hsa05020 )
- Cocaine addiction (hsa05030 )
- Amphetamine addiction (hsa05031 )
- Morphine addiction (hsa05032 )
- Alcoholism (hsa05034 )
- Vibrio cholerae infection (hsa05110 )
- Amoebiasis (hsa05146 )
- Human cytomegalovirus infection (hsa05163 )
- Human papillomavirus infection (hsa05165 )
- Human T-cell leukemia virus 1 infection (hsa05166 )
- Pathways in cancer (hsa05200 )
- Viral carcinogenesis (hsa05203 )
- Proteoglycans in cancer (hsa05205 )
- Chemical carcinogenesis - receptor activation (hsa05207 )
- Dilated cardiomyopathy (hsa05414 )
|
| Reactome Pathway |
- PKA-mediated phosphorylation of key metabolic factors (R-HSA-163358 )
- Triglyceride catabolism (R-HSA-163560 )
- PKA activation (R-HSA-163615 )
- PKA activation in glucagon signalling (R-HSA-164378 )
- DARPP-32 events (R-HSA-180024 )
- Regulation of PLK1 Activity at G2/M Transition (R-HSA-2565942 )
- Loss of Nlp from mitotic centrosomes (R-HSA-380259 )
- Recruitment of mitotic centrosome proteins and complexes (R-HSA-380270 )
- Loss of proteins required for interphase microtubule organization from the centrosome (R-HSA-380284 )
- Recruitment of NuMA to mitotic centrosomes (R-HSA-380320 )
- Glucagon-like Peptide-1 (GLP1) regulates insulin secretion (R-HSA-381676 )
- Rap1 signalling (R-HSA-392517 )
- Regulation of insulin secretion (R-HSA-422356 )
- Vasopressin regulates renal water homeostasis via Aquaporins (R-HSA-432040 )
- VEGFA-VEGFR2 Pathway (R-HSA-4420097 )
- CREB1 phosphorylation through the activation of Adenylate Cyclase (R-HSA-442720 )
- Interleukin-3, Interleukin-5 and GM-CSF signaling (R-HSA-512988 )
- Ion homeostasis (R-HSA-5578775 )
- Degradation of GLI1 by the proteasome (R-HSA-5610780 )
- Degradation of GLI2 by the proteasome (R-HSA-5610783 )
- GLI3 is processed to GLI3R by the proteasome (R-HSA-5610785 )
- Hedgehog 'off' state (R-HSA-5610787 )
- Anchoring of the basal body to the plasma membrane (R-HSA-5620912 )
- CD209 (DC-SIGN) signaling (R-HSA-5621575 )
- MAPK6/MAPK4 signaling (R-HSA-5687128 )
- RET signaling (R-HSA-8853659 )
- AURKA Activation by TPX2 (R-HSA-8854518 )
- HDL assembly (R-HSA-8963896 )
- ROBO receptors bind AKAP5 (R-HSA-9010642 )
- Loss of phosphorylation of MECP2 at T308 (R-HSA-9022535 )
- Regulation of MECP2 expression and activity (R-HSA-9022692 )
- GPER1 signaling (R-HSA-9634597 )
- Regulation of glycolysis by fructose 2,6-bisphosphate metabolism (R-HSA-9634600 )
- ADORA2B mediated anti-inflammatory cytokines production (R-HSA-9660821 )
- FCGR3A-mediated IL10 synthesis (R-HSA-9664323 )
- Factors involved in megakaryocyte development and platelet production (R-HSA-983231 )
- PKA-mediated phosphorylation of CREB (R-HSA-111931 )
|
|
|
|
|
|
|
