Details of the Drug Therapeutic Target (DTT)
General Information of Drug Therapeutic Target (DTT) (ID: TTVF2BJ)
| DTT Name | Lactosylceramide alpha-2,3-sialyltransferase (ST3GAL5) | ||||
|---|---|---|---|---|---|
| Synonyms | UNQ2510/PRO5998; Sialyltransferase 9; ST3Gal V; ST3GAL5; Ganglioside GM3 synthase; CMP-NeuAc:lactosylceramide alpha-2,3-sialyltransferase | ||||
| Gene Name | ST3GAL5 | ||||
| DTT Type |
Literature-reported target
|
[1] | |||
| BioChemical Class |
Glycosyl transferase
|
||||
| UniProt ID | |||||
| TTD ID | |||||
| 3D Structure | |||||
| EC Number |
EC 2.4.99.9
|
||||
| Sequence |
MRTKAAGCAERRPLQPRTEAAAAPAGRAMPSEYTYVKLRSDCSRPSLQWYTRAQSKMRRP
SLLLKDILKCTLLVFGVWILYILKLNYTTEECDMKKMHYVDPDHVKRAQKYAQQVLQKEC RPKFAKTSMALLFEHRYSVDLLPFVQKAPKDSEAESKYDPPFGFRKFSSKVQTLLELLPE HDLPEHLKAKTCRRCVVIGSGGILHGLELGHTLNQFDVVIRLNSAPVEGYSEHVGNKTTI RMTYPEGAPLSDLEYYSNDLFVAVLFKSVDFNWLQAMVKKETLPFWVRLFFWKQVAEKIP LQPKHFRILNPVIIKETAFDILQYSEPQSRFWGRDKNVPTIGVIAVVLATHLCDEVSLAG FGYDLNQPRTPLHYFDSQCMAAMNFQTMHNVTTETKFLLKLVKEGVVKDLSGGIDREF |
||||
| Function | Catalyzes the formation of ganglioside GM3 (alpha-N- acetylneuraminyl-2,3-beta-D-galactosyl-1, 4-beta-D- glucosylceramide). | ||||
| KEGG Pathway | |||||
| Reactome Pathway | |||||
| BioCyc Pathway | |||||
Molecular Interaction Atlas (MIA) of This DTT
| Molecular Interaction Atlas (MIA) | ||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
1 Investigative Drug(s) Targeting This DTT
|
||||||||||||||||||||||||||||
