Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTVLU5N)

• DTT Name: HUMAN programmed cell death protein 1 (PD-1)
• Synonyms: hPD1; hPD-1; Protein PD1; Protein PD-1; PD1; CD279
• Gene Name: PDCD1
• BioChemical Class: Immunoglobulin
• UniProt ID: PDCD1_HUMAN
• TTD ID: T02957
• Sequence:
  MQIPQAPWPVVWAVLQLGWRPGWFLDSPDRPWNPPTFSPALLVVTEGDNATFTCSFSNTS
  ESFVLNWYRMSPSNQTDKLAAFPEDRSQPGQDCRFRVTQLPNGRDFHMSVVRARRNDSGT
  YLCGAISLAPKAQIKESLRAELRVTERRAEVPTAHPSPSPRPAGQFQTLVVGVVGGLLGS
  LVLLVWVLAVICSRAARGTIGARRTGQPLKEDPSAVPVFSVDYGELDFQWREKTPEPPVP
  CVPEQTEYATIVFPSGMGTSSPARRGSADGPRSAQPLRPEDGHCSWPL
• Function: Delivers inhibitory signals upon binding to ligands CD274/PDCD1L1 and CD273/PDCD1LG2. Following T-cell receptor (TCR) engagement, PDCD1 associates with CD3-TCR in the immunological synapse and directly inhibits T-cell activation. Suppresses T-cell activation through the recruitment of PTPN11/SHP-2: following ligand-binding, PDCD1 is phosphorylated within the ITSM motif, leading to the recruitment of the protein tyrosine phosphatase PTPN11/SHP-2 that mediates dephosphorylation of key TCR proximal signaling molecules, such as ZAP70, PRKCQ/PKCtheta and CD247/CD3zeta. Inhibitory receptor on antigen activated T-cells that plays a critical role in induction and maintenance of immune tolerance to self.
• KEGG Pathway:
  Cell adhesion molecules (hsa04514)
  T cell receptor signaling pathway (hsa04660)
  PD-L1 expression and PD-1 checkpoint pathway in cancer (hsa05235)
• Reactome Pathway:
  Potential therapeutics for SARS (R-HSA-9679191)
  PD-1 signaling (R-HSA-389948)

Molecular Interaction Atlas (MIA) of This DTT

1 Investigative Agents Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Camrelizumab	DMVAP4T	Coronavirus Disease 2019 (COVID-19)	1D6Y	Investigative	[1]

References

• [1] ClinicalTrials.gov (NCT04268537) Immunoregulatory Therapy for 2019-nCoV. U.S. National Institutes of Health.