Details of the Drug Therapeutic Target (DTT)
General Information of Drug Therapeutic Target (DTT) (ID: TTVMO5W)
| DTT Name | Interleukin-25 (IL25) | ||||
|---|---|---|---|---|---|
| Synonyms | UNQ3120/PRO10272; Interleukin-17E; IL17E; IL-25; IL-17E | ||||
| Gene Name | IL25 | ||||
| DTT Type | 
                     Clinical trial target 
                 | 
                [1] | |||
| BioChemical Class | 
                     Cytokine: interleukin 
                 | 
            ||||
| UniProt ID | |||||
| TTD ID | |||||
| 3D Structure | |||||
| Sequence | 
                                         
                        MRERPRLGEDSSLISLFLQVVAFLAMVMGTHTYSHWPSCCPSKGQDTSEELLRWSTVPVP 
                    
                PLEPARPNRHPESCRASEDGPLNSRAISPWRYELDRDLNRLPQDLYHARCLCPHCVSLQT GSHMDPRGNSELLYHNQTVFYRRPCHGEKGTHKGYCLERRLYRVSLACVCVRPRVMG  | 
            ||||
| Function | Proinflammatory cytokine favoring Th2-type immune responses. Induces activation of NF-kappa-B and stimulates production of the proinflammatory chemokine IL-8. | ||||
| KEGG Pathway | |||||
| Reactome Pathway | |||||
Molecular Interaction Atlas (MIA) of This DTT
| Molecular Interaction Atlas (MIA) | ||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| 
                     1 Clinical Trial Drug(s) Targeting This DTT 
                                            
  | 
            ||||||||||||||||||||||||||||
