Details of the Drug Therapeutic Target (DTT)
General Information of Drug Therapeutic Target (DTT) (ID: TTVNA43)
| DTT Name | Bacterial Deoxy-D-manno-octulosonate 8-phosphate synthase (Bact kdsA) | ||||
|---|---|---|---|---|---|
| Synonyms | 
                                         
                        kdsA; Phospho-2-dehydro-3-deoxyoctonate aldolase; KDOPS; KDOP synthase; KDO8PS; KDO8P synthase; KDO8-P synthase; KDO-8-phosphate synthetase; 3-deoxy-D-manno-octulosonic acid 8-phosphate synthetase; 3-Deoxy-d-manno-2-octulosonate-8-phosphate synthase; 2-dehydro-3-deoxyphosphooctonate aldolase
                        
                     
                                     | 
            ||||
| Gene Name | Bact kdsA | ||||
| DTT Type | 
                     Literature-reported target 
                 | 
                [1] | |||
| BioChemical Class | 
                     Alkyl aryl transferase 
                 | 
            ||||
| UniProt ID | |||||
| TTD ID | |||||
| 3D Structure | |||||
| Sequence | 
                                         
                            MKQKVVSIGDINVANDLPFVLFGGMNVLESRDLAMRICEHYVTVTQKLGIPYVFKASFDK 
                        
                    ANRSSIHSYRGPGLEEGMKIFQELKQTFGVKIITDVHEPSQAQPVADVVDVIQLPAFLAR QTDLVEAMAKTGAVINVKKPQFVSPGQMGNIVDKFKEGGNEKVILCDRGANFGYDNLVVD MLGFSIMKKVSGNSPVIFDVTHALQCRDPFGAASGGRRAQVAELARAGMAVGLAGLFIEA HPDPEHAKCDGPSALPLAKLEPFLKQMKAIDDLVKGFEELDTSK  | 
            ||||
| Function | Synthesis of KDO 8-P which is required for lipid A maturation and cellular growth. | ||||
| KEGG Pathway | |||||
| BioCyc Pathway | |||||
Molecular Interaction Atlas (MIA) of This DTT
| Molecular Interaction Atlas (MIA) | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| 
                     8 Investigative Drug(s) Targeting This DTT 
                                        
  | 
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
