Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTVP9IQ)

• DTT Name: Solute carrier family 28 member 2 (SLC28A2)
• Synonyms: hCNT2; Sodium/purine nucleoside co-transporter; Sodium/nucleoside cotransporter 2; Sodium-coupled nucleoside transporter 2; SPNT; Na(+)/nucleoside cotransporter 2; Concentrative nucleoside transporter 2; CNT2; CNT 2
• Gene Name: SLC28A2
• DTT Type: Literature-reported target; [1]
• UniProt ID: S28A2_HUMAN
• TTD ID: T94627
• Sequence:
  MEKASGRQSIALSTVETGTVNPGLELMEKEVEPEGSKRTDAQGHSLGDGLGPSTYQRRSR
  WPFSKARSFCKTHASLFKKILLGLLCLAYAAYLLAACILNFQRALALFVITCLVIFVLVH
  SFLKKLLGKKLTRCLKPFENSRLRLWTKWVFAGVSLVGLILWLALDTAQRPEQLIPFAGI
  CMFILILFACSKHHSAVSWRTVFSGLGLQFVFGILVIRTDLGYTVFQWLGEQVQIFLNYT
  VAGSSFVFGDTLVKDVFAFQALPIIIFFGCVVSILYYLGLVQWVVQKVAWFLQITMGTTA
  TETLAVAGNIFVGMTEAPLLIRPYLGDMTLSEIHAVMTGGFATISGTVLGAFIAFGVDAS
  SLISASVMAAPCALASSKLAYPEVEESKFKSEEGVKLPRGKERNVLEAASNGAVDAIGLA
  TNVAANLIAFLAVLAFINAALSWLGELVDIQGLTFQVICSYLLRPMVFMMGVEWTDCPMV
  AEMVGIKFFINEFVAYQQLSQYKNKRLSGMEEWIEGEKQWISVRAEIITTFSLCGFANLS
  SIGITLGGLTSIVPHRKSDLSKVVVRALFTGACVSLISACMAGILYVPRGAEADCVSFPN
  TSFTNRTYETYMCCRGLFQSTSLNGTNPPSFSGPWEDKEFSAMALTNCCGFYNNTVCA
• Function: Sodium-dependent and purine-selective transporter. Exhibits the transport characteristics of the nucleoside transport system cif or N1 subtype (N1/cif) (selective for purine nucleosides and uridine). Plays a critical role in specific uptake and salvage of purine nucleosides in kidney and other tissues.
• Reactome Pathway:
  Azathioprine ADME (R-HSA-9748787)
  Transport of nucleosides and free purine and pyrimidine bases across the plasma membrane (R-HSA-83936)

Molecular Interaction Atlas (MIA) of This DTT

1 Investigative Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
PMID25815140C48	DMUEDBP	Discovery agent	N.A.	Investigative	[1]

The Drug Transporter (DTP) Role of This DTT

• DTT DTP Name: Concentrative nucleoside transporter 2 (SLC28A2) DTP Info
• Gene Name: SLC28A2

5 Approved Drug(s) Transported by This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Didanosine	DMI2QPE	Human immunodeficiency virus infection	1C62	Approved	[2]
Entecavir	DM7VTQO	Hepatitis B virus infection	1E51.0	Approved	[3]
Mercaptopurine	DMTM2IK	Acute lymphoblastic leukaemia	2A85	Approved	[4]
Ribavirin	DMEYLH9	Hepatitis C virus infection	1E51.1	Approved	[5]
Uridine	DMQTREB	Depression	6A70-6A7Z	Approved	[6]

References

• [1] Identification of 8-aminoadenosine derivatives as a new class of human concentrative nucleoside transporter 2 inhibitors. ACS Med Chem Lett. 2015 Jan 28;6(3):244-8.
• [2] Clinical Nephrotoxins: Renal Injury from Drugs and Chemicals.
• [3] Multiple SLC and ABC Transporters Contribute to the Placental Transfer of Entecavir. Drug Metab Dispos. 2017 Mar;45(3):269-278.
• [4] PharmGKB: A worldwide resource for pharmacogenomic information. Wiley Interdiscip Rev Syst Biol Med. 2018 Jul;10(4):e1417. (ID: PA2040)
• [5] Identification and functional analysis of variants in the human concentrative nucleoside transporter 2, hCNT2 (SLC28A2) in Chinese, Malays and Indians. Pharmacogenet Genomics. 2007 Sep;17(9):783-6.
• [6] Transport of ribavirin across the rat and human placental barrier: Roles of nucleoside and ATP-binding cassette drug efflux transporters. Biochem Pharmacol. 2019 May;163:60-70.