Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTWG0RE)

DTT Name	C-X-C motif chemokine 11 (CXCL11)
Synonyms	Small-inducible cytokine B11; SCYB9B; SCYB11; Interferon-inducible T-cell alpha chemoattractant; Interferon gamma-inducible protein 9; ITAC; IP-9; I-TAC; H174; Beta-R1
Gene Name	CXCL11
DTT Type	Literature-reported target	[1]
BioChemical Class	Cytokine: CXC chemokine
UniProt ID	CXL11_HUMAN
TTD ID	T68465
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Sequence	MSVKGMAIALAVILCATVVQGFPMFKRGRCLCIGPGVKAVKVADIEKASIMYPSNNCDKI EVIITLKENKGQRCLNPKSKQARLIIKKVERKNF
Function	Induces calcium release in activated T-cells. Binds to CXCR3. May play an important role in CNS diseases which involve T-cell recruitment. May play a role in skin immune responses. Chemotactic for interleukin-activated T-cells but not unstimulated T-cells, neutrophils or monocytes.
KEGG Pathway	Cytokine-cytokine receptor interaction (hsa04060 ) Viral protein interaction with cytokine and cytokine receptor (hsa04061 ) Chemokine signaling pathway (hsa04062 ) Toll-like receptor signaling pathway (hsa04620 )
Reactome Pathway	G alpha (i) signalling events (R-HSA-418594 ) Chemokine receptors bind chemokines (R-HSA-380108 )

References

1	Chemokine (C-X-C motif) ligand 11 levels predict survival in cirrhotic patients with transjugular intrahepatic portosystemic shunt. Liver Int. 2016 Mar;36(3):386-94.