Details of the Drug Therapeutic Target (DTT)
General Information of Drug Therapeutic Target (DTT) (ID: TTWP7HQ)
| DTT Name | CYP3A4 messenger RNA (CYP3A4 mRNA) | ||||
|---|---|---|---|---|---|
| Synonyms |
Taurochenodeoxycholate 6-alpha-hydroxylase (mRNA); Quinine 3-monooxygenase (mRNA); P450-PCN1 (mRNA); Nifedipine oxidase (mRNA); NF-25 (mRNA); HLp (mRNA); Cytochrome P450-PCN1 (mRNA); Cytochrome P450 NF-25 (mRNA); Cytochrome P450 HLp (mRNA); Cytochrome P450 3A4 (mRNA); Cytochrome P450 3A3 (mRNA); CYPIIIA4 (mRNA); CYPIIIA3 (mRNA); CYP3A3 (mRNA); Albendazole sulfoxidase (mRNA); Albendazole monooxygenase (sulfoxide-forming) (mRNA); 1,8-cineole 2-exo-monooxygenase (mRNA)
|
||||
| Gene Name | CYP3A4 | ||||
| DTT Type |
Clinical trial target
|
[1] | |||
| BioChemical Class |
mRNA target
|
||||
| UniProt ID | |||||
| TTD ID | |||||
| 3D Structure | |||||
| EC Number |
EC 1.14.14.-
|
||||
| Sequence |
MALIPDLAMETWLLLAVSLVLLYLYGTHSHGLFKKLGIPGPTPLPFLGNILSYHKGFCMF
DMECHKKYGKVWGFYDGQQPVLAITDPDMIKTVLVKECYSVFTNRRPFGPVGFMKSAISI AEDEEWKRLRSLLSPTFTSGKLKEMVPIIAQYGDVLVRNLRREAETGKPVTLKDVFGAYS MDVITSTSFGVNIDSLNNPQDPFVENTKKLLRFDFLDPFFLSITVFPFLIPILEVLNICV FPREVTNFLRKSVKRMKESRLEDTQKHRVDFLQLMIDSQNSKETESHKALSDLELVAQSI IFIFAGYETTSSVLSFIMYELATHPDVQQKLQEEIDAVLPNKAPPTYDTVLQMEYLDMVV NETLRLFPIAMRLERVCKKDVEINGMFIPKGVVVMIPSYALHRDPKYWTEPEKFLPERFS KKNKDNIDPYIYTPFGSGPRNCIGMRFALMNMKLALIRVLQNFSFKPCKETQIPLKLSLG GLLQPEKPVVLKVESRDGTVSGA |
||||
| Function |
In liver microsomes, this enzyme is involved in an NADPH-dependent electron transport pathway. It performs a variety of oxidation reactions (e. g. caffeine 8-oxidation, omeprazole sulphoxidation, midazolam 1'-hydroxylation and midazolam 4-hydroxylation) of structurally unrelated compounds, including steroids, fatty acids, and xenobiotics. Acts as a 1,8-cineole 2-exo-monooxygenase. The enzyme also hydroxylates etoposide. Catalyzes 4-beta-hydroxylation of cholesterol. May catalyze 25-hydroxylation of cholesterol in vitro. Catalyzes sulfoxidation of the anthelmintics albendazole and fenbendazole. Cytochromes P450 are a group of heme-thiolate monooxygenases.
|
||||
| KEGG Pathway |
|
||||
| Reactome Pathway | |||||
| BioCyc Pathway | |||||
Molecular Interaction Atlas (MIA) of This DTT
| Molecular Interaction Atlas (MIA) | ||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
1 Clinical Trial Drug(s) Targeting This DTT
|
||||||||||||||||||||||||||||
