Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTWRN6M)

DTT Name	CRP messenger RNA (CRP mRNA)
Synonyms	PTX1 (mRNA); C-reactive protein (mRNA)
Gene Name	CRP
DTT Type	Clinical trial target	[1]
BioChemical Class	mRNA target
UniProt ID	CRP_HUMAN
TTD ID	T52953
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Sequence	MEKLLCFLVLTSLSHAFGQTDMSRKAFVFPKESDTSYVSLKAPLTKPLKAFTVCLHFYTE LSSTRGYSIFSYATKRQDNEILIFWSKDIGYSFTVGGSEILFEVPEVTVAPVHICTSWES ASGIVEFWVDGKPRVRKSLKKGYTVGAEASIILGQEQDSFGGNFEGSQSLVGDIGNVNMW DFVLSPDEINTIYLGGPFSPNVLNWRALKYEVQGEVFTKPQLWP
Function	Can interact with DNA and histones and may scavenge nuclear material released from damaged circulating cells. Displays several functions associated with host defense: it promotes agglutination, bacterial capsular swelling, phagocytosis and complement fixation through its calcium-dependent binding to phosphorylcholine.
Reactome Pathway	Classical antibody-mediated complement activation (R-HSA-173623 )

Molecular Interaction Atlas (MIA) of This DTT

Molecular Interaction Atlas (MIA)

Jump to Detail Molecular Interaction Atlas of This DTT

2 Clinical Trial Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
ISIS-CRPRx	DML84CN	Coronary artery disease	BA80	Phase 2	[1]
ISIS-CRP	DMQDUG4	Cardiovascular disease	BA00-BE2Z	Phase 1	[2]
------------------------------------------------------------------------------------

7 Investigative Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
ISIS 133712	DMDZ3FU	Discovery agent	N.A.	Investigative	[3]
ISIS 133726	DMJ56XU	Discovery agent	N.A.	Investigative	[3]
ISIS 140180	DMP9WOZ	Discovery agent	N.A.	Investigative	[3]
ISIS 329956	DMA96KW	Discovery agent	N.A.	Investigative	[3]
ISIS 330012	DMWIVS9	Discovery agent	N.A.	Investigative	[3]
ISIS 330031	DM35WFL	Discovery agent	N.A.	Investigative	[3]
Phosphocholine	DMIZLVW	Discovery agent	N.A.	Investigative	[4]
------------------------------------------------------------------------------------


⏷ Show the Full List of 7 Investigative Drug(s)

References

1	Antisense oligonucleotides on neurobehavior, respiratory, and cardiovascular function, and hERG channel current studies. J Pharmacol Toxicol Methods. 2014 Jan-Feb;69(1):49-60.
2	Clinical pipeline report, company report or official report of ISIS Pharmaceuticals (2009).
3	US patent application no. 7,425,545, Modulation of C-reactive protein expression.
4	How many drug targets are there Nat Rev Drug Discov. 2006 Dec;5(12):993-6.